DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14086 and Tmem72

Sequence 1:NP_649102.3 Gene:CG14086 FlyBaseID:FBgn0036860 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_848883.2 Gene:Tmem72 MGIID:2442707 Length:275 Species:Mus musculus

Alignment Length:179 Identity:40/180 (22%)
Similarity:74/180 (41%) Gaps:26/180 (14%)


  Fly    34 RVFGLLTSFVICGVGVDVYMHGYRAGL--YIVFSAVLVMFIEIKWLVTIFLQL--QCAEDNYQRR 94
            |:.|:.|:.|:.|||.:.::.|....|  |::|:.|.:...|..:.|...|.:  :|...:...|
Mouse    15 RLLGIATAAVLIGVGTETFLRGRFKSLAFYLLFTGVTISVCEGTYFVAQLLAICFKCQPGSLAHR 79

  Fly    95 SCSCLACWRLSAICGGWRPTPVYAVIGICLILYPHNLWLSYVAGMFLILLGLLRLCTLLRFSASK 159
            :.. .|.|     .|.::....|.::.:...|:|..:|...:.|..||:.||    .....|..|
Mouse    80 AKE-RAHW-----LGCFQKFLAYMLLSVACFLHPVLVWHVTIPGSMLIITGL----AYFLLSKRK 134

  Fly   160 EEGLLPQCDFEKVSSFVDTMEDDFAEIGATQAGLD-------EEAEEEG 201
            ::...|:     |:...:...|..:.:.:|....|       .||.:||
Mouse   135 KKKAAPE-----VAPPTEQYTDPSSSVVSTTGSGDTEQTYTFHEAFKEG 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14086NP_649102.3 TMEM72 29..>138 CDD:292672 24/108 (22%)
Tmem72NP_848883.2 TMEM72 2..189 CDD:292672 40/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR28474
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.