DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14086 and tmem72

Sequence 1:NP_649102.3 Gene:CG14086 FlyBaseID:FBgn0036860 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_002939601.3 Gene:tmem72 XenbaseID:XB-GENE-1013599 Length:272 Species:Xenopus tropicalis

Alignment Length:143 Identity:32/144 (22%)
Similarity:58/144 (40%) Gaps:30/144 (21%)


  Fly    32 VIRVFGLLTSFVICGVGVDVYMHGY--RAGLYIVFSAVLVMFIEIKWLVTIFLQLQCAEDNYQRR 94
            :.|..|:.|:.|:.|||::......  ..|.|::|.:.::...|..:.:.|||            
 Frog    13 ICRFLGISTAAVLTGVGIETLQQAQFPSLGYYLLFCSGILFVCEGSFFLHIFL------------ 65

  Fly    95 SCSCLACWRLSA-----IC-------GGWRPTPVYAVIGICLILYPHNLWLSYVAGMFLILLGLL 147
                .:|:|..|     :|       ||::....|.::.:...|:|..:|...:.|..||:.|:.
 Frog    66 ----TSCFRCQAEPRLYVCLGKTGRMGGFQKFVGYGLLSVACFLHPVLVWHVTIPGTMLIVTGMA 126

  Fly   148 RLCTLLRFSASKE 160
            .|....|....||
 Frog   127 YLLLSKRKKFDKE 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14086NP_649102.3 TMEM72 29..>138 CDD:292672 24/120 (20%)
tmem72XP_002939601.3 TMEM72 2..187 CDD:292672 32/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1128211at2759
OrthoFinder 1 1.000 FOG0007380
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.