DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14085 and si:ch73-280o22.2

Sequence 1:NP_649101.2 Gene:CG14085 FlyBaseID:FBgn0036859 Length:874 Species:Drosophila melanogaster
Sequence 2:XP_017211821.1 Gene:si:ch73-280o22.2 ZFINID:ZDB-GENE-141216-272 Length:1278 Species:Danio rerio

Alignment Length:872 Identity:184/873 (21%)
Similarity:325/873 (37%) Gaps:220/873 (25%)


  Fly   100 FVQLVTKSADLLLEHIHRLSQESLDHADLSVLTATIGAASLVKNSLSVY-MQAATTTICPPKGDE 163
            :|::..:....||..:...:.|....|.|..|...:..:..:..:||.| .|....:..|     
Zfish   513 YVEVCGRVTSSLLVRLEERAWEVPTSAPLKNLPVLMATSVFIHQTLSYYESQLRDVSRMP----- 572

  Fly   164 KGGALKLSFKQYSQ-MSEALAERLLDLHCRLLLLYIMQDADCLHWEDTQPFFESERGSYTVQMWW 227
                |.|...|.|| :..||.:.|......:....|:|||:..:|.|..||:|.||.|:::|||.
Zfish   573 ----LTLLPVQRSQDVMAALHDHLTSYCTNVCATSILQDAESHYWSDPNPFYEGERCSFSIQMWQ 633

  Fly   228 HYMRGSQTDLWNSVPPKMAQKIFAGMLNETLSVLTVRYTQIVTSVARSTLHLVDICNMLLCIAEL 292
            :::||.::|||.||.|..|::..|.:|.|||.:|..||::...|..|.:...|||..:|.|:..|
Zfish   634 YFLRGLRSDLWGSVGPVQARQTLAQVLCETLELLVQRYSRARPSYKRLSQIRVDITALLQCVEHL 698

  Fly   293 LPHICESGEAYV---GLQLSNQSVIIRDIHAKCKELFYCLLLRGSPLGVLSKVFRKGL----DNM 350
            :..:|:|.|..:   |...|.    |..||:.|.:|...|::..|||..|.:||..|.    |..
Zfish   699 MWSVCDSAEELLRPDGAPGSR----IYCIHSLCNQLLTILIILTSPLAELHRVFPAGCGSRGDGS 759

  Fly   351 EMFSSRHGLPS---AWIIFALPRYFPKEQSCQWVTEFSDLSTNTAISLDLRVLLAFPEADWSYLL 412
            .......|:.|   .|:....|..|.:|    .:.:||. |..:::.| |.:|::.|..:.:.||
Zfish   760 RSVKFSEGMSSQDTKWLSVINPTLFTQE----LLRDFSS-SEGSSLCL-LELLVSGPGFNPALLL 818

  Fly   413 KILLMRDAYLTGIIMRHLMQYLPSSENFKNVAKISFTSAEGAPQKCEAFLCRGECFNVTDSIAGD 477
            :.:|.:|..|..||:.:                 |....:|..:         |..|...|.|.|
Zfish   819 QTILHKDCLLLQIIISY-----------------SCLCVDGGTE---------ESPNTPMSAAED 857

  Fly   478 -IDPVGQSNYQIVLSLTYLVVAVGKAVDIKSCLIKTLEEHAIAGWSDCLDKRQVW--------NQ 533
             ::.|    :.|:.|:.:...|:.:|::               |:   ||:|.:|        ..
Zfish   858 FLEAV----FAILSSVNHFPRALTRALE---------------GY---LDRRHLWEHFYNLAETS 900

  Fly   534 KRTPWL-----EAIMHFMYPVLDCVVDMLVNAVENGASMYQ------------------------ 569
            |..|.|     ..:....|.:...:|:|:.:..:....:.:                        
Zfish   901 KEDPALFKYIKSVVCESTYKLQIQLVNMMQSCKDPSGPLVRQQLPENILGKIPKEWNYIAQDQKC 965

  Fly   570 ------AMSLALTCVSEIWDCLPEGLYKIASLLQDIIPVSTRPLGDSVLLQVVFAALYTELIKTA 628
                  :|:|.:..:|.|:..||.   .||||     |:..|               :..::...
Zfish   966 NDINKSSMNLVIQALSFIFTHLPS---TIASL-----PLPVR---------------FLFIVAEK 1007

  Fly   629 EMYEQAKDL-DKAAICYSISEAICSIDEDDKHTDQIELFLKQ-----AKESINLDTDFGGTAGSN 687
            .:.:.||.| ....:.:.:...:|   :|.::.|.:|....|     ||:.:.|.::....:...
Zfish  1008 RLSQHAKQLRSTGLLLWVLLLCLC---QDLENGDALEHLSGQPLERGAKDRLGLLSECLQVSLGQ 1069

  Fly   688 NRGAGGMSAVSTIKMDDLALTNAESDRLSHSPPNNYAMEL---------------------DVGI 731
            .:|.            ...|.:.....|....|...:::|                     |.|:
Zfish  1070 QKGV------------PKPLVHKVLQGLEEKRPKWTSLQLQKARKLCCESVFERVESGSAQDRGV 1122

  Fly   732 ADYIAEVLVSDVLTTNI----GKQALKVVYNYLKFNKDWLLEQL-------------------GT 773
            ...:.|..:..:|....    |.|.|:.:::.::.|:|.|...|                   .|
Zfish  1123 PAELTEHKIRQLLLELCHRAGGSQHLRQIHHSIQLNEDLLRSVLIPHSKTNAPPDSPLGPVVFST 1187

  Fly   774 GDNDPSPFQGIQGQNIKEAKTSVLRSMFFIGNTPFDQLLTGSLKIDYVSWLQMPLSLNPERTCLH 838
            .::||         |...:..:.||....||:..|||...|..:.|:...|....:::.......
Zfish  1188 EESDP---------NTHLSHFNPLREFNSIGHNKFDQGALGEREWDWAQLLPAYQNMSQVTFTTL 1243

  Fly   839 LNRRCDFQEDAKLSLPEVAMVAGITKI 865
            |..|.:.|:.|:|...|..:|..:.||
Zfish  1244 LANRWEMQDAAELEDEEKILVDQLKKI 1270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14085NP_649101.2 DUF4495 99..430 CDD:291567 99/342 (29%)
si:ch73-280o22.2XP_017211821.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CA28
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007219
OrthoInspector 1 1.000 T1054260
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR33960
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5691
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.