DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14085 and 2210408I21Rik

Sequence 1:NP_649101.2 Gene:CG14085 FlyBaseID:FBgn0036859 Length:874 Species:Drosophila melanogaster
Sequence 2:NP_001139148.1 Gene:2210408I21Rik MGIID:1919621 Length:1272 Species:Mus musculus

Alignment Length:933 Identity:184/934 (20%)
Similarity:326/934 (35%) Gaps:286/934 (31%)


  Fly    72 PSGLLHTEKEMNE--GDFSSVTVKTSD-----------------PDKFVQLVTKSADLLLEHIHR 117
            |.|.:..|:|..:  ..|.|..::..|                 .:..|:..:|.|..:||.:..
Mouse   469 PEGHIFPEEEQPKRVAKFCSDIIEKLDTMLLLALACRDDSPQEIKENLVEAYSKVATAVLERLQE 533

  Fly   118 LSQESLDHADLSVLTATIGAASLVKNSLSVYMQAATTTICPPKGDEKGGALKLSFKQYSQMSEAL 182
            ..:|....|.|..|.:.:.:|:.|....:.|......|...|       ...:..::|.:....:
Mouse   534 RGKEVPSRAPLKNLHSILSSATYVSQRFTHYDNLMKETTKKP-------IFLVPVQRYQEFINTV 591

  Fly   183 AERLLDLHCRLLLLYIMQDADCLHWEDTQPFFESERGSYTVQMWWHYMRGSQTDLWNSVPPKMAQ 247
            ..::.|...|:..:.|:|||:..||:|.:.|:|.||.|:.:|||.::......|||..:|||:||
Mouse   592 QFQVTDYCARVCAMSILQDAESHHWDDYKAFYEGERCSFAIQMWHYFSLALHHDLWTILPPKLAQ 656

  Fly   248 KIFAGMLNETLSVLTVRYTQIVTSVARSTLHLVDICNMLLCIAELLPHICESGEAYVGLQLSNQS 312
            :|.|.||.::|.:|..||.:...|..|:....:|:..:|:....:|..||.||:..:.....|..
Mouse   657 EILAEMLEKSLGLLASRYARAHPSPKRTAQIRLDVMAILIFTENMLWSICSSGQEILNPHKFNNH 721

  Fly   313 VIIRDIHAKCKELFYCLLLRGSPLGVLSKVFRKGLDNMEMFSSRHGL------PSAWIIFALPRY 371
            .|.: ||..|..||..|.:..|||..|.|.|:.|:|.    |..:.|      |..| |..:.::
Mouse   722 KIFK-IHTHCNNLFTTLAILTSPLTELYKTFQHGVDE----SPSNSLTPLFNQPLHW-ISCMSQF 780

  Fly   372 FP---KEQSCQWVTEFSDLSTNTAISLDLRVLLAFPEADWSYLLKILLMRDAYLTGIIMR----- 428
            :|   :..|...:|...          .|::||:.|...|:.||..||.....:..|:::     
Mouse   781 YPSLLRPPSVGGLTAQG----------QLKLLLSQPCCKWNLLLDTLLHSGGLIPRILLKSSKQA 835

  Fly   429 ------------------------HLMQYLPSSENFKNVAKISFTSAEGAPQKCEAFLCRGECFN 469
                                    ||     ||:.|.||    |.|.....|..: ||     ||
Mouse   836 AGMESKQSAGGSLVGAIFEVLYHCHL-----SSQTFGNV----FMSHMEEEQLWD-FL-----FN 885

  Fly   470 VTDSIAGDIDPVG---QSNYQIVLSLTYLVV-----AVGKAVDIKSCLIKTLEEHAIAGWSDCLD 526
            :         ||.   :|..:::..|...::     .|.:.:.|..|. :..|.:.         
Mouse   886 I---------PVSSFTESQPEVIHCLRLALMDSVKDTVQQIISIMRCR-RNSETNL--------- 931

  Fly   527 KRQVWNQKRTPWLEAIMHFMYPVLDCVVDMLVNAVENGASMY------------------QAMSL 573
                 |:.|.|                 |.|:.::..|.:..                  ||:|:
Mouse   932 -----NKPRVP-----------------DHLLQSIPQGWNYIPRDSRGKESNKGITELAAQAVSI 974

  Fly   574 ALTCVSEIWDCLPEGLYKIASLLQDIIPVSTRPLGDSVLLQVVFAALYTELIKTAEMYEQAKDLD 638
            .|:.:..:..|||..:.....|.:..:..:...|..:.||      ::..:|....::|....::
Mouse   975 VLSKLPTVIACLPPTIKYFFFLSERKMSKNLAELKKAGLL------VWNLIIIICRIFEDGNTVE 1033

  Fly   639 K--------------AAICYSISEAICSIDEDDKHTDQIELFLKQAK-----------ESINLDT 678
            :              ..||..:...:.......:.|.::.|.:::.|           .::::..
Mouse  1034 RLTGSSLDRWSKEKLGLICLCLESILGKQSNPSQLTQKVILSIERQKPNWMEQQLLKARTLSIQC 1098

  Fly   679 DFGGTAGSNNRGAGGMSAVSTIKMDDLALTNAESDRLSHSPPNNYAMELDVGIADYIAEVLVSDV 743
            .|  |....|.|:.|.:|:...:..    |||....|.|.|.                       
Mouse  1099 AF--TRMEENSGSEGEAALELTEQK----TNAMVLDLCHKPG----------------------- 1134

  Fly   744 LTTNIGKQALKVVYNYLKFNKDWLLEQLGTGDNDPSPFQGIQGQNIKEAKTSVLRSM-------- 800
                 |.:.|:.:|:.::.|:::|.|||             ...|..|.|..::|.:        
Mouse  1135 -----GSKYLQQIYHIMQLNEEYLKEQL-------------FAMNGSEEKPLLIRPLKVALRDED 1181

  Fly   801 -----------FFIGNTPFDQLLTGSLKIDYVSWLQMPLSLN----------------------P 832
                       ..:..:..||:.|.:...|:.:.|...|.||                      .
Mouse  1182 QPPAFNPFHVHKVVSESMLDQVATVTWCCDWSNLLPNYLGLNKMTFGALFKNRWEMRKDETLEEK 1246

  Fly   833 ERTCL-HLNRRCDFQE----DAK 850
            |:..| ||.:.|..|:    |:|
Mouse  1247 EKMMLEHLKQNCTIQDFSTSDSK 1269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14085NP_649101.2 DUF4495 99..430 CDD:291567 92/369 (25%)
2210408I21RikNP_001139148.1 DUF4495 515..832 CDD:291567 91/340 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CA28
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007219
OrthoInspector 1 1.000 T1085100
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR33960
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5691
TreeFam 1 0.960
76.990

Return to query results.
Submit another query.