DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14085 and RGD1560883

Sequence 1:NP_649101.2 Gene:CG14085 FlyBaseID:FBgn0036859 Length:874 Species:Drosophila melanogaster
Sequence 2:XP_017446642.1 Gene:RGD1560883 RGDID:1560883 Length:1303 Species:Rattus norvegicus

Alignment Length:854 Identity:181/855 (21%)
Similarity:310/855 (36%) Gaps:201/855 (24%)


  Fly   101 VQLVTKSADLLLEHIHRLSQESLDHADLSVLTATIGAASLVKNSLSVYMQAATTTICPPKGDEKG 165
            |:...|.|..:||.:.....|....|.|..|...:.:|..:......|......|...|      
  Rat   547 VEACCKVATAVLERLRERGTEVPSRAPLKNLHIILSSAVYISQWFMHYDNLMKETAKKP------ 605

  Fly   166 GALKLSFKQYSQMSEALAERLLDLHCRLLLLYIMQDADCLHWEDTQPFFESERGSYTVQMWWHYM 230
             ...:..::|.:....:..:|.|...|:....|:|||:..||||.:.|:|.||.|:.:|||.::.
  Rat   606 -IFLVPVQRYQEFISTVQFQLTDYCIRVCATSILQDAESHHWEDYKAFYEGERCSFAIQMWHYFS 669

  Fly   231 RGSQTDLWNSVPPKMAQKIFAGMLNETLSVLTVRYTQIVTSVARSTLHLVDICNMLLCIAELLPH 295
            .....|||..:|||:||:|.|.:|.::|.:|..||.:...|..|:....:||..:|:|..::|..
  Rat   670 WALHHDLWTILPPKLAQEILAELLEKSLGLLASRYARAHPSPRRTAQIRLDITAILICTEKMLWS 734

  Fly   296 ICESGEAYVGLQLSNQSVIIRDIHAKCKELFYCLLLRGSPLGVLSKVFRKGLDN--MEMFSSRHG 358
            :|.|.:..:.....|...|.: ||..|..||..|.:..|||..|.|.|:.|.|.  ...|:....
  Rat   735 VCTSEQEILNPHKYNHHKIFK-IHIHCNNLFTTLAILTSPLTELYKTFQDGRDESASNAFTPLFN 798

  Fly   359 LPSAWIIFALPRYFPKEQSCQWVTEF--SDLSTNTAISL----DLRVLLAFPEADWSYLLKILLM 417
            .|..||            ||  :::|  |.|...:|..|    .|::||:.|....:.||:.||.
  Rat   799 QPLHWI------------SC--LSQFHPSLLRPPSARELTAQGQLKLLLSQPCCKGNLLLETLLH 849

  Fly   418 RDAYLTGIIMRHLMQ-------------------------YLPSSENFKNVAKISFTSAEGAPQK 457
            .|..:..|:::...|                         :| |.:.|.||    |||.....|.
  Rat   850 GDGLIARILLKSAKQAAGMESKQSAGCSVVGTIFEVLYWCHL-SPQTFGNV----FTSHMEEEQL 909

  Fly   458 CEAFLCRGECFNVTDSIAGDIDPVGQSNYQIVLSLTYLVV-----AVGKAVDIKSCLIKTLEEHA 517
            .: |||     |:..|...:..|      :::..|...::     .|.:.:.:..|         
  Rat   910 WD-FLC-----NIPVSAFTESQP------EVIRCLRLALIDSVKDTVQQIISMVKC--------- 953

  Fly   518 IAGWSDC---LDKRQV-----------WN--QKRTPWLEAIMHFMYPVLDCVVDMLVNAVENGAS 566
               |.:.   |:|..|           ||  .:.:.|.|:...|.                  ..
  Rat   954 ---WRNSETKLNKPPVPDHLLQSIPREWNYIPRDSTWKESNKGFT------------------RL 997

  Fly   567 MYQAMSLALTCVSEIWDCLPEGLYKIASLLQDIIPVSTRPLGDSVLLQVVFAALYTELIKTAEMY 631
            ..||:|:.|:.:..:..|||..:.....|.:..:..:...|..:.||......:...:.:.....
  Rat   998 AAQAVSIVLSKLPTVIACLPPTIKYFFFLSERKMSKNVAELKKAGLLVWNLIVIICRIFEDGNTV 1062

  Fly   632 EQ--AKDLDK------AAICYSISEAICSIDEDDKHTDQIELFLKQAK-----------ESINLD 677
            |:  ...||:      ..||..:...:.......:.|.::.|.::|..           .::|::
  Rat  1063 ERLTGSSLDRWSKEKLGLICLCLESILGEQSSPSQLTQKVILHIEQQSPNWIEHQLLKARTLNIE 1127

  Fly   678 TDFGGTAGSNNRGAGGMSAVSTIKMDDLALTNAESDRLSHSPPNNYAMELDVGIADYIAEVLVSD 742
                 .|.....|:.|....:.:::.: ..|||....|.|.|.                      
  Rat  1128 -----CASMPVEGSSGSEGDAVLELTE-QKTNAMVLDLCHKPG---------------------- 1164

  Fly   743 VLTTNIGKQALKVVYNYLKFNKDWLLEQL---GTGDNDPSPFQGIQGQNIKEAKTSVLRSMFF-- 802
                  |.:.|:.:|:.::.|:::|.|||   ...:..|.|.     |.:|||    ||:..:  
  Rat  1165 ------GSKYLQQIYHIMQLNEEYLKEQLLAMNGSEEKPFPI-----QPLKEA----LRNGEYQP 1214

  Fly   803 -----------IGNTPFDQLLTGSLKIDYVSWLQMPLSLNPERTCLHLNRRCDFQEDAKLSLPEV 856
                       ...:..||..|.:...|:.:.|...|.|:.......|..|.:.::|..|...|.
  Rat  1215 PAFDPFHVHKVFSESMLDQAATATWYWDWSNLLPNYLGLDKMTFGPLLKNRWEMRKDETLEKNEK 1279

  Fly   857 AMVAGITKI 865
            .|:..:.:|
  Rat  1280 MMLEHLKQI 1288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14085NP_649101.2 DUF4495 99..430 CDD:291567 94/337 (28%)
RGD1560883XP_017446642.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CA28
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007219
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR33960
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.