DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14085 and KIAA0825

DIOPT Version :10

Sequence 1:NP_649101.2 Gene:CG14085 / 40099 FlyBaseID:FBgn0036859 Length:874 Species:Drosophila melanogaster
Sequence 2:XP_011541626.1 Gene:KIAA0825 / 285600 HGNCID:28532 Length:1341 Species:Homo sapiens


Alignment Length:113 Identity:28/113 - (24%)
Similarity:39/113 - (34%) Gaps:32/113 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NDFLVRPKRIR---------CYTQLSTLPIDLIIEILSRLPMN---------SIAIC-----RLV 47
            :|...|.:|.|         |.||.|.|.:|  |:.|...|..         ..|:|     |:.
Human  1146 DDPTAREERARLASNLQWPSCPTQYSELQVD--IQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVT 1208

  Fly    48 S--KQWASILQSSDFTESFLIKSPPRPRLLFTIRYGSKWHLFSAPQPR 93
            .  |...|....:...:|.||.:|..|.:.|.:....     .||.||
Human  1209 EAPKHPISEELETPIKDSHLIPTPQAPSIAFPLANPP-----VAPHPR 1251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14085NP_649101.2 DUF4495 99..430 CDD:464363
KIAA0825XP_011541626.1 DUF4495 515..832 CDD:464363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.