DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14085 and KIAA0825

Sequence 1:NP_649101.2 Gene:CG14085 FlyBaseID:FBgn0036859 Length:874 Species:Drosophila melanogaster
Sequence 2:XP_011541626.1 Gene:KIAA0825 HGNCID:28532 Length:1341 Species:Homo sapiens

Alignment Length:844 Identity:186/845 (22%)
Similarity:320/845 (38%) Gaps:228/845 (27%)


  Fly    61 WEDEY-FASYRKPSGLLHTEKEMNEGDFSSVTVKTSD----------PDKF-------VQLVTKS 107
            |:|.: |....:|..:         |.|.|..::..|          .|.|       |:...|.
Human   468 WQDSHMFPEEEQPKKI---------GKFCSDIMEKLDTMLPLALACRDDSFQEIRANLVEACCKV 523

  Fly   108 ADLLLEHIHRLSQESLDHADLSVLTATIGAASLVKNSLSVY---MQAATTTICPPKGDEKGGALK 169
            |..:|:.:...::|....|.|..|...:..|..|......|   |:..|          |.....
Human   524 ATAVLQRLQERAKEVPSKAPLKNLHTYLSTAVYVFQHFKRYDNLMKEMT----------KKPIFL 578

  Fly   170 LSFKQYSQMSEALAERLLDLHCRLLLLYIMQDADCLHWEDTQPFFESERGSYTVQMWWHYMRGSQ 234
            :..::|.:....|..::.:...|:....|:|||:..||:|.:.|:|.||.|:::|||.::.....
Human   579 VLVQRYQEFINTLQFQVTNYCVRVCATSILQDAESHHWDDYKAFYEGERCSFSIQMWHYFCWSLH 643

  Fly   235 TDLWNSVPPKMAQKIFAGMLNETLSVLTVRYTQIVTSVARSTLHLVDICNMLLCIAELLPHICES 299
            .|||..:|||:||:|...:|.::||:|..||.:...|..|:....:|:..:|:|...:|..:|.|
Human   644 YDLWTILPPKLAQEILVEVLEKSLSLLASRYARAHPSRKRTPQLRLDVTTILICTENMLWSVCTS 708

  Fly   300 GEAYVGLQLSNQSVIIRDIHAKCKELFYCLLLRGSPLGVLSKVFRKGLDNMEMFSSRHGLPSAWI 364
            .:..:.........|.: ||..|..||..|::..|||..|.|.|:.|||.    |:...|.|   
Human   709 VQKLLNPHQHTDDKIFK-IHTHCNNLFTTLVILTSPLTELYKTFQHGLDE----SASDSLKS--- 765

  Fly   365 IFALPRYFPKEQSCQWVTEF--SDLSTNTAISL----DLRVLLAFPEADWSYLLKILLMRDAYLT 423
            .|..|.|:   .||  ::.|  |.|.|.:|..|    .|::||:.|..:|:.||:.||..|..|.
Human   766 FFKQPLYW---VSC--ISHFYPSLLRTPSAGGLKAEGQLKLLLSQPRCNWNLLLETLLHHDGLLL 825

  Fly   424 GIIM----RHLMQYLPSSEN------------FKNVAKISFTSAEGAPQK-CEAFLCRGECFNVT 471
            .|::    |...:.:..:||            ||.:...||     :||. ...|:...|...:.
Human   826 RILLKSSKRTFQEQVSDTENNLNQGPSLMEAIFKILYHCSF-----SPQTFANVFVSYMEEEQLW 885

  Fly   472 DSIAGDIDPVGQSNYQIVLSLTYLVVAVGKAVDIKSCL-------IKTLEEHAIAGWSDCLDKRQ 529
            |.:           |.|.:|     ..|...:::..||       ||...:..::          
Human   886 DFL-----------YNIPVS-----TCVEYELEVIRCLRLALTDAIKDTVQQIVS---------- 924

  Fly   530 VWNQKRTPWLEAIMHFMYPVLDCVVDML----------VNAVENGASM----YQAMSLALTCVSE 580
            |.:.:|........|.   |.||:::.:          .|..|:..|.    .||:|:.::.:..
Human   925 VMSSRRNCETNLNKHI---VPDCLLESMPKEWNYSPKETNRKESCKSFTRLTAQAVSIVISKLPT 986

  Fly   581 IWDCLPEGLYKIASLLQDIIPVSTRPLGDSVLLQVVFAALYTELIKTAEMYEQAKDLDKAA-ICY 644
            :..|||.             ||.                 |...:...:|.::..:|.||. :.:
Human   987 VIACLPP-------------PVK-----------------YFFFLSERKMSKKFVELKKAGLLVW 1021

  Fly   645 SISEAICSIDEDDKHTDQIELFL-----KQAKESINLDTDFGGTAGSNNRGAGGMSAVSTIKMDD 704
            ::...||.|.||.   :.:||..     :.:||.:.|.                ...:.:|..|.
Human  1022 NLIVIICRIFEDG---NTVELLTGASLDRWSKEKLGLI----------------CMCLKSIMGDQ 1067

  Fly   705 LALTNAESDRLSHS----PPNNYAMEL------------------------DVG--IADYIAEVL 739
            .::.|....::..|    .||....:|                        ||.  :.:.....:
Human  1068 TSIHNQMIQKVIQSIEQQKPNWIERQLLKARKLSTECAFMTIEKSTALQEGDVALELTEQKINTM 1132

  Fly   740 VSDVLTTNIGKQALKVVYNYLKFNKDWLLEQL---GTGDNDPSPFQGIQGQNIKEAKTSVLRSM 800
            |.|:.....|::.|:.:|:.::.|:::|.|||   .:.:..|.|        |:..||: |||:
Human  1133 VLDLCHKPGGREYLRQIYHIMQLNEEYLKEQLFSMNSSEEKPLP--------IRPLKTT-LRSI 1187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14085NP_649101.2 DUF4495 99..430 CDD:291567 99/351 (28%)
KIAA0825XP_011541626.1 DUF4495 515..832 CDD:291567 97/340 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CA28
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007219
OrthoInspector 1 1.000 T1074996
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR33960
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5691
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.