DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14085 and KIAA0825

DIOPT Version :9

Sequence 1:NP_649101.2 Gene:CG14085 / 40099 FlyBaseID:FBgn0036859 Length:874 Species:Drosophila melanogaster
Sequence 2:XP_011541626.1 Gene:KIAA0825 / 285600 HGNCID:28532 Length:1341 Species:Homo sapiens


Alignment Length:113 Identity:28/113 - (24%)
Similarity:39/113 - (34%) Gaps:32/113 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NDFLVRPKRIR---------CYTQLSTLPIDLIIEILSRLPMN---------SIAIC-----RLV 47
            :|...|.:|.|         |.||.|.|.:|  |:.|...|..         ..|:|     |:.
Human  1146 DDPTAREERARLASNLQWPSCPTQYSELQVD--IQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVT 1208

  Fly    48 S--KQWASILQSSDFTESFLIKSPPRPRLLFTIRYGSKWHLFSAPQPR 93
            .  |...|....:...:|.||.:|..|.:.|.:....     .||.||
Human  1209 EAPKHPISEELETPIKDSHLIPTPQAPSIAFPLANPP-----VAPHPR 1251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14085NP_649101.2 DUF4495 99..430 CDD:464363
KIAA0825XP_011541626.1 DUF4495 515..832 CDD:464363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 - -
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.