DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14085 and kiaa0825

Sequence 1:NP_649101.2 Gene:CG14085 FlyBaseID:FBgn0036859 Length:874 Species:Drosophila melanogaster
Sequence 2:XP_002933482.2 Gene:kiaa0825 XenbaseID:XB-GENE-877130 Length:1260 Species:Xenopus tropicalis

Alignment Length:879 Identity:177/880 (20%)
Similarity:330/880 (38%) Gaps:228/880 (26%)


  Fly    86 DFSSVTVKTSDPDKFVQLVTKSADLLLEHIHRLSQESLDHADLSVLTATIGAASLVKNSLSVYMQ 150
            |.|.:.|:..    |::..:|.|.|:|..:....:|....|.|..:.||:..|..|.:.|:.|..
 Frog   500 DVSLLDVRAC----FLEAFSKVAALILAKLEEHHKEFPCKASLQSMYATLSTAIYVLHHLNYYSV 560

  Fly   151 AATTTICPPKGDEKGGALKLSFKQYSQMSEALAERLLDLHCRLLLLYIMQDADCLHWEDTQPFFE 215
            ..:          |.....::.::|.:....|...::.....:....|.|||:..:|:|.:.|:|
 Frog   561 QMS----------KKSLFLVAVQRYQEFINNLQADVIQYCISVCSTSIFQDAESHNWDDNKEFYE 615

  Fly   216 SERGSYTVQMWWHYMRGSQTDLWNSVPPKMAQKIFAGMLNETLSVLTVRYTQIVTSVARSTLHLV 280
            .||.|:::|||.::..|.:.|||..:||.:||.||..::.:||::||.||:|:..:..|.:...|
 Frog   616 GERCSFSIQMWHYFCCGLRHDLWTILPPLLAQDIFKEVVEQTLALLTFRYSQVHPNYKRVSQIRV 680

  Fly   281 DICNMLLCIAELLPHICESGEAYVGLQLSNQSVIIRDIHAKCKELFYCLLLRGSPLGVLSKVFRK 345
            ||..:..|:..:|..:|.|.:..:..........:: ||..|..|...:.:..:||..|.|...|
 Frog   681 DIMAIFSCVENMLWSVCNSTQDLMRPTSQANGTTLK-IHNYCNSLLPVMAVLSTPLETLHKAITK 744

  Fly   346 GLDNMEMFSSR--HGLPSAWIIFALPRYFPKEQSCQWVTEFSDLSTNTAISL----DLRVLLAFP 404
            .|.......|:  |.:|..|||:..|.          :..||. .|.:|:.:    .|::||:.|
 Frog   745 ELSGFPSSPSKQPHSVPLEWIIYLKPE----------LVLFSS-KTPSAVEMAVQGQLKLLLSQP 798

  Fly   405 EADWSYLLKILLMRDAYLTGIIMRHLMQYLPSSENFKNVAKISFTSAEGAPQKCEAFLCRGECFN 469
            ..:|:.||:.||..|..:...:.         :.:...:||.:...:|..|  |.|         
 Frog   799 CCNWNLLLETLLHSDCLVAKTLF---------ACSINEIAKRNHEDSESNP--CLA--------- 843

  Fly   470 VTDSIAGDIDPVGQSNYQIVLSLTYLVVAVGKAVDIKSCLIKTLEEHAIAGWSDCLDKRQVWNQK 534
                             :::||:........|.:.|      .:|.:        :|:.::|:  
 Frog   844 -----------------EMILSVLSYCTLTPKLLSI------VVENY--------MDQEKLWD-- 875

  Fly   535 RTPWLEAIMHFMYPVLDC------VVDMLVNAVENGASMYQAMSLALTCVSEIWDCLPEGLYK-- 591
                      |:..:..|      |:..|.|.::...........:|....|:.:|....:||  
 Frog   876 ----------FLCSITGCRAFVPYVIRYLKNTLKKSVLGIVKQVTSLIVSRELMECPNSCMYKYS 930

  Fly   592 IASLLQDIIPVS-----------------TRPLGDSVLLQV-----VFAAL-------------- 620
            |...|.|::|..                 |:.:.::|.:.:     |.|.:              
 Frog   931 IPETLLDVVPEKWKLTSRKTNIKASKKGLTKLIAEAVSIVIGRLPSVIACVPSPIKYLYSLAERK 995

  Fly   621 ----YTELIKT-----------AEMYEQAKDLDKA---AICYSISEAICSIDE-----------D 656
                |:|.|||           .|:......::.|   |:.....|.:.::.|           |
 Frog   996 VSKKYSESIKTGILVLNLIDIICEVLHDGNTIENATGHALSTWCKENLTAVSECLQRVTGNKTND 1060

  Fly   657 DKHTDQ-------------IE-LFLKQAKESINLDTDFGGTAGSNNRGAGGMSAVSTIKMDDLAL 707
            :|...|             || .|||....|||                    :.|.::.|...|
 Frog  1061 NKEATQKVFDIIGEKRPKWIENQFLKANSLSIN--------------------SGSAMQEDSSVL 1105

  Fly   708 TNAESDRLSHSPPNNYAMELDVGIADYIAEVLVSDVLTTNIGKQALKVVYNYLKFNKDWLLEQLG 772
            .:.:|             ||:  :.:....::|.|:.....|.:.|:.:|:.::.|:|:|..:..
 Frog  1106 KDQDS-------------ELE--LTEQRINMMVLDICHKPGGSKYLRQIYHIIQLNEDYLNAEFS 1155

  Fly   773 TGDND-----PSPFQ-GIQGQNIKEAKTSVLRSMFFIGNTPFDQLLTGSLKIDYVSWLQMPLSLN 831
            |.:.|     ...|| .:.|...:.::.:.|.|...    |...:|:.....|:.|.|...|:::
 Frog  1156 TQEPDKISAHSRNFQFNLTGGEDQLSRFNPLHSFIL----PASDVLSEHSTTDWHSLLSCCLAVH 1216

  Fly   832 PERTCLHLNRRCDFQEDAKLSLPEVAMVAGITKI 865
            |......|.||.: .:|..:|..|..::|.:.::
 Frog  1217 PLTFQALLERRWE-TKDENISEEEKMLLAQLKQM 1249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14085NP_649101.2 DUF4495 99..430 CDD:291567 87/337 (26%)
kiaa0825XP_002933482.2 DUF4495 510..824 CDD:291567 87/345 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007219
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.