DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rept and RVB1

DIOPT Version :9

Sequence 1:NP_001262040.1 Gene:rept / 40092 FlyBaseID:FBgn0040075 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_010476.1 Gene:RVB1 / 851771 SGDID:S000002598 Length:463 Species:Saccharomyces cerevisiae


Alignment Length:439 Identity:192/439 - (43%)
Similarity:285/439 - (64%) Gaps:15/439 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGK 79
            :.|..||:||:|||||:...|:.|..|.|||.:||.|.||:|.:::..|::||.|||||.|||||
Yeast    21 VTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGK 85

  Fly    80 TAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEI--- 141
            ||:|:.::|.||.:.||..:.|||:||:|:.|||.|.:..|::||:||||..|:.||||.|:   
Yeast    86 TALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPE 150

  Fly   142 QIERPASGTGQKVGKVT--LKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRS 204
            ..|.|..|.|:.:..|.  ||:.:......|...|.|...:||:..||||.|:..:|.|.::|||
Yeast   151 DAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRS 215

  Fly   205 FTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHG-------FLALFSGDTG 262
            ...|.::|....:  :|..|:||:.|:||:|..||||::||.|:|..|       ...|......
Yeast   216 DAYATEFDLETEE--YVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKT 278

  Fly   263 EIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRG 327
            ||.:::|.::|..|.::.::|.||:.|||||||||:|||||.|::||:||||::|||||:|:|||
Yeast   279 EITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRG 343

  Fly   328 ITRIRGT-NYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIAT 391
            :|.:||| :..||||:|.||:||::|:||:||.:.|::.|::.|...|...:...||.:|..:.|
Yeast   344 MTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGT 408

  Fly   392 DTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILK 440
            :||||||:||:....::.:.....|:...||.:...||||..||:|||:
Yeast   409 ETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILE 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
reptNP_001262040.1 TIP49 17..408 CDD:283678 180/403 (45%)
P-loop_NTPase 69..>113 CDD:304359 25/43 (58%)
AAA <267..358 CDD:99707 52/91 (57%)
RVB1NP_010476.1 TIP49 4..463 CDD:224145 192/439 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1224
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.