DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and Fzd10

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_780493.1 Gene:Fzd10 MGIID:2136761 Length:582 Species:Mus musculus

Alignment Length:676 Identity:277/677 (41%)
Similarity:351/677 (52%) Gaps:157/677 (23%)


  Fly     9 LILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCR 73
            |.|.|.:::.||.|   :.|.|               ...||.|          :|:.:.||||:
Mouse     8 LWLVLQVMIGSCTA---ISSMD---------------LERPGDG----------KCQPVEIPMCK 44

  Fly    74 GIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRS 138
            .||||.|..||.|.||.|.||.:::|:|.||||..|...|:|||||:|.|:|.|....|:|.||.
Mouse    45 DIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRV 109

  Fly   139 VCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSG---- 199
            :||:||..|:|||:|:.|.||:.:.|..||...||:.||||.|      :.||...|.|||    
Mouse   110 MCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAP------NNGSDEPSRGSGMFPP 168

  Fly   200 ------SGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGK----ECS 254
                  ..|......|.||.|..|                      |.||      ||    |.|
Mouse   169 LFRPQRPHSAQEHPLKDGGPGRAG----------------------CDNP------GKFHHVEKS 205

  Fly   255 CSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGL 319
            .||                                       .|.| .|....::|.|:|.||.:
Mouse   206 ESC---------------------------------------APLC-TPGVDVYWSRDDKRFAVV 230

  Fly   320 WIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLL 384
            |:|:||.|||.|:..|:.||:||..||:||||||:|||.||.:.:|||:.|.|...|.||||   
Mouse   231 WLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACD--- 292

  Fly   385 LRES-----------STGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQ 438
             |:|           |||   ||||||:.|:||||||:|||:|:.|||||||.|||:|||..:|.
Mouse   293 -RDSGQLYVIQEGLESTG---CTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSS 353

  Fly   439 YFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGF 503
            |||||||.||.|:::.:|::..|.||.:.|:||||:::.:.|..|||.||..||||||:|:::||
Mouse   354 YFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGF 418

  Fly   504 VSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALA 568
            |:||.||.|:|.     .|...|||||||:|||:||:|||||||.||.||.||....:.| |.||
Mouse   419 VALFHIRRVMKT-----GGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYW-KMLA 477

  Fly   569 C--PCA---QVKGPG-----KKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGA 623
            .  .|.   |.|.|.     ..|...|.|:|..|.|.||||||||:|:.|||:||:....|.|..
Mouse   478 TQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGLKR 542

  Fly   624 PDR-------TGANQALIKQRPPIPH 642
            ..|       |.|......|.|..||
Mouse   543 KSRRKPASVVTSAGIYKKAQHPQKPH 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 61/119 (51%)
Frizzled 308..618 CDD:279827 172/331 (52%)
Fzd10NP_780493.1 CRD_FZ 31..157 CDD:295308 65/142 (46%)
Frizzled 219..536 CDD:279827 172/330 (52%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. {ECO:0000250} 527..532 4/5 (80%)
PDZ-binding 580..582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D237456at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.