DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and Fzd1

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_067089.2 Gene:Fzd1 RGDID:61916 Length:642 Species:Rattus norvegicus

Alignment Length:658 Identity:279/659 (42%)
Similarity:362/659 (55%) Gaps:127/659 (19%)


  Fly    12 GLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAP-------------GYGVPVIPKDPNLR 63
            ||:|||....|  ||...........:.|.|..|.|.|             |..:|     .:..
  Rat    53 GLLLLLWLLEA--PLLLGVRAQAAGQVSGPGQQAPPPPQPQQGGQQYNGERGISIP-----DHGY 110

  Fly    64 CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPIC--L 126
            |:.|:||:|..|.||.|..||.:.|..|::||||||||:|||:::||.:|||||||||.|:|  |
  Rat   111 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL 175

  Fly   127 EDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGS 191
            |   :.||.|||:|||||.||..:|.::.|:||:.:.||..|:|| ...||:.|           
  Rat   176 E---QALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHG-AGELCVGQ----------- 225

  Fly   192 SGGSGGSGSGSGS------GGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASG 250
              .:...|:.:.|      ....:.||.|..|...||:                     |....|
  Rat   226 --NTSDKGTPTPSLLPEFWTSNPQHGGGGYRGGYPGGA---------------------GPVERG 267

  Fly   251 K-ECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGP------F 308
            | .|..:.|.|.                        |:|   ....|..:||.||:..      :
  Rat   268 KFSCPRALRVPS------------------------YLN---YHFLGEKDCGAPCEPTKVYGLMY 305

  Fly   309 FSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFL 373
            |..:|..|:..||.:||.||..|||.|:.|:::|..||.||||||:|||.||..|||.|:: .||
  Rat   306 FGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIA-GFL 369

  Fly   374 QNEEIAC------DGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEA 432
            ..:.:.|      ||.......|....||::|::.|||.|||||||||||.|||||||:|||:||
  Rat   370 LEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEA 434

  Fly   433 ITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTT 497
            |..:|||||||||.:|.::::.:|.|..||||.:.|:|:||..|.|.|:.||||||||||.|||:
  Rat   435 IEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTS 499

  Fly   498 FLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFED 562
            ||:||||||||||:::|..     |.|.:||||||:|||:|||||||||||||.||.||.|:.:.
  Rat   500 FLLAGFVSLFRIRTIMKHD-----GTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQ 559

  Fly   563 W--------IKALACPCAQVKG-------PGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLES 612
            |        .|:.|.||..::|       |...|.::|.|:||.|.|.||||||.||||||||.|
  Rat   560 WERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNS 624

  Fly   613 WRRFWRRL 620
            ||:|:.||
  Rat   625 WRKFYTRL 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 63/121 (52%)
Frizzled 308..618 CDD:279827 178/331 (54%)
Fzd1NP_067089.2 CRD_FZ1 107..233 CDD:143574 64/143 (45%)
Frizzled 305..629 CDD:279827 178/330 (54%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. {ECO:0000250} 620..625 4/5 (80%)
PDZ-binding 640..642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.