DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and fzd8b

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_571628.1 Gene:fzd8b ZFINID:ZDB-GENE-000328-4 Length:576 Species:Danio rerio

Alignment Length:605 Identity:318/606 (52%)
Similarity:393/606 (65%) Gaps:71/606 (12%)


  Fly    64 CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLED 128
            |:||::|:|||||||.|..||:.||:.|||||||||||||||||:|||||:||||||||||||||
Zfish    31 CQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLED 95

  Fly   129 YHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSG 193
            |.||||.||||||||::||||:|:||.|.||:||.|:.||:.|||:.|||:. :.|:|   .||.
Zfish    96 YKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGDPNTLCMDY-NRTDA---TSSP 156

  Fly   194 GSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCR 258
            .:..:.|..|...|||.          ..|.||:|.:|                      .|.||
Zfish   157 AAPKTTSRPGKPFKRKN----------KSSPGSSSCEP----------------------ECYCR 189

  Fly   259 SPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIAL 323
            :|::               .:|..||...|..  :...:|||.:||..|:.|.:|:.||..||.:
Zfish   190 APMV---------------PVHSDHHPLYNRV--KTGQIPNCAMPCHNPYLSQEERTFATFWIGI 237

  Fly   324 WSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL----L 384
            ||.|||.||..|:.||:||.||||||||||:||||||..|::||:.|....:|.:||:..    .
Zfish   238 WSVLCFLSTFATVATFLIDIERFKYPERPIIFLSACYMFVSLGYIIRLIAGHERVACNQNHEVDH 302

  Fly   385 LRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPT 449
            :...:|||..|||||||.|||||||:|||||||||||||||||||||||.::|||||:||||||:
Zfish   303 IHYETTGPALCTLVFLLIYFFGMASAIWWVILSFTWFLAAGLKWGNEAIARYSQYFHMAAWLIPS 367

  Fly   450 VQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIK 514
            |:|:.||.||:||||.|.|||||||.|.|:|:.||||||.:||.|||.||.|||||:||||||||
Zfish   368 VKSITVLALSSVDGDSIAGICYVGNQNLDNLRGFVLAPLVIYLFIGTIFLFAGFVSMFRIRSVIK 432

  Fly   515 QQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGK 579
            |     .|.|.||||:||:|||:|:|||||.|.:::.||:||....|.|..|.||.|:..| ...
Zfish   433 Q-----GGTKTDKLERLMVRIGVFTVLYTVVAIMIVACYVYEHHNREAWEIAHACNCSSDK-KAP 491

  Fly   580 KPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPHPY 644
            ||.|:|.||||||.|.:|||||.|.||.|||:|||....|.......|......:       :..
Zfish   492 KPDYAVFMLKYFMCLLIGITSGAWTWSSKTLDSWRALCTRCCCCRWATKGTSGSV-------YSD 549

  Fly   645 AGSGMGMPVGSAAGSLLATP 664
            |.||:....|:|: |:|..|
Zfish   550 ASSGLTWRSGTAS-SVLCPP 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 86/118 (73%)
Frizzled 308..618 CDD:279827 194/314 (62%)
fzd8bNP_571628.1 CRD_FZ8 27..151 CDD:143570 87/121 (72%)
Frizzled 222..534 CDD:279827 195/318 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D237456at33208
OrthoFinder 1 1.000 FOG0001786
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132674
Panther 1 1.100 O PTHR11309
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.