DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and fzd3b

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001074070.1 Gene:fzd3b ZFINID:ZDB-GENE-070122-1 Length:667 Species:Danio rerio

Alignment Length:731 Identity:229/732 (31%)
Similarity:323/732 (44%) Gaps:177/732 (24%)


  Fly    10 ILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRG 74
            ||.:|.||:...|   :|..       .:|.|.|                  ..||.|.:.||:.
Zfish    14 ILSVVSLLSGSMA---IHMD-------SVGSHSL------------------FTCESIGLRMCQD 50

  Fly    75 IGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSV 139
            :.||.|..||.:||..|..|.|.:..|.|:|.::|||||:.|||::|.|:|:|.....|| |||:
Zfish    51 LPYNNTFMPNLLNHYDQQTAALAMEPFHPMVNLQCSPDLRPFLCALYAPVCMEYGRVSLP-CRSL 114

  Fly   140 CERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGS 204
            |..|:..|..:|..:...|||.|.|...|   |.|.      ||..|                  
Zfish   115 CHHAKRDCQKLMDMFGVTWPEEMECTRFP---DCDE------SYPRA------------------ 152

  Fly   205 GGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQL 269
                                                                          |.|
Zfish   153 --------------------------------------------------------------EDL 155

  Fly   270 L-----QQQSQMPMMHHPHHWY-MNLTVQ-----RIAGVPNCGIPCKGPFFSNDEKDFAGLWIAL 323
            |     ..||.|.:......|. ..|.::     ...||.:|..||...:|..:|..||..:|.:
Zfish   156 LVIDDPTDQSPMSVQRDYGFWCPRELKMEPDLGYTFLGVRDCSPPCPNMYFRREELTFARYFIGV 220

  Fly   324 WSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRES 388
            .|.:|..:||.|..||:||..||:||||||:|.:.||.||::.:. ..||..:.:||:.....:.
Zfish   221 VSIVCLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLVFF-LGFLLEDRVACNSANPGQY 284

  Fly   389 ST-----GPH--SCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWL 446
            .|     |.|  :|||:|::.|||.||.|:|||||:.||||||..|||:|||.|.:..||.:||.
Zfish   285 KTSTVTQGSHNKACTLLFMVLYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWG 349

  Fly   447 IPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRS 511
            ||.:.::|:|.|:.::||.|.|:|:||..:...|:.||||||.:.:::|.:.|:||.|:|.|:|.
Zfish   350 IPGMLTIALLALNKIEGDNISGVCFVGVYDVQTLRWFVLAPLCLDVLVGVSLLLAGIVALNRVRM 414

  Fly   512 VIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDW--------IKALA 568
            .|..:     ....:||.|.|||||:|||||.||...|:||||||..|...|        .:...
Zfish   415 EIPLE-----KENQEKLVKFMIRIGVFSVLYLVPLLTVVGCYLYEQTYRSVWETTWVQERCREYH 474

  Fly   569 CPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQAL 633
            .||........:|...:.::||.|.|.|||.|..|:.|.||...|..|:.     ..|...:.|:
Zfish   475 IPCPFKVEQTSRPDLVLFLIKYLMVLVVGIPSVFWVGSKKTCFEWAGFFH-----GRRRKDSGAV 534

  Fly   634 IKQRPPIPHPYAGSGMGMPVGSAAGSLLATPYT----QAGGASVASTSHHHLHHHV-----LKQP 689
            .:.|..:..|           ..|.|||..|.|    ::.|.|...||.|....|:     ::..
Zfish   535 HESRQVLQDP-----------DFAQSLLRDPNTPIVRKSRGTSTQGTSTHASSTHLAMLDDVRSK 588

  Fly   690 AASHVXHGESGGASTM 705
            |:|  .|.:|...|::
Zfish   589 ASS--VHSKSSFHSSL 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 47/119 (39%)
Frizzled 308..618 CDD:279827 135/325 (42%)
fzd3bNP_001074070.1 CRD_FZ 36..162 CDD:295308 54/234 (23%)
Frizzled 205..524 CDD:279827 135/325 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.