DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and sfrp2

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001070852.2 Gene:sfrp2 ZFINID:ZDB-GENE-061013-293 Length:294 Species:Danio rerio

Alignment Length:138 Identity:52/139 (37%)
Similarity:75/139 (54%) Gaps:7/139 (5%)


  Fly    41 HGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLV 105
            |||.|...|    .:..|..|.:.....:.:|..|.|.....||.:.|||.:|...:...:.|||
Zfish    21 HGLYAFDQP----ELFQKKSNCKPIPTNLLLCHDIEYTNMRLPNLLGHETMNEVLQQASSWTPLV 81

  Fly   106 EIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLH 170
            :.:|.||.|.||||::.|:||:|..:|:..|||:||..:|||||:|..:.|.||:.:.|...||.
Zfish    82 QKQCHPDTKKFLCSLFAPVCLDDLDEPIQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFPLD 146

  Fly   171 GDPDNLCM 178
            .|   ||:
Zfish   147 ND---LCI 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 45/117 (38%)
Frizzled 308..618 CDD:279827
sfrp2NP_001070852.2 CRD_SFRP2 34..161 CDD:143555 47/122 (39%)
NTR_Sfrp1_like 167..294 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.