DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and fzd7

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001016741.1 Gene:fzd7 XenbaseID:XB-GENE-483731 Length:548 Species:Xenopus tropicalis

Alignment Length:637 Identity:270/638 (42%)
Similarity:356/638 (56%) Gaps:138/638 (22%)


  Fly    17 LTSCRADGPLHSAD--HGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNM 79
            |..|....|..||.  ||..|:.:..||.                    |:.|:||:|..|.||.
 Frog     7 LLFCLLLQPSPSAQQYHGEKGISVPDHGF--------------------CQPISIPLCTDIAYNQ 51

  Fly    80 TSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPIC--LEDYHKPLPVCRSVCER 142
            |..||.:.|..|::||||||||:|||:::|||:|:|||||||.|:|  ||   :.:|.|||:|||
 Frog    52 TIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLE---QAIPPCRSLCER 113

  Fly   143 ARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGK 207
            ||.||..:|.::.|:||||:.||:.|:|                                     
 Frog   114 ARQGCEALMNKFGFQWPERLRCENFPIH------------------------------------- 141

  Fly   208 RKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLI--------FL 264
                       |||        :.|.|:|:.: .:|.|..|.        .:|.:        .|
 Frog   142 -----------GAG--------EICVGQNTSD-NSPSGPTAR--------PTPYLPDSITFHPHL 178

  Fly   265 GKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGP-------FFSNDEKDFAGLWIA 322
            .::....:|.::|    |:..|      |..|..:||.||: |       :|..:|..||.||:.
 Frog   179 NRDFTCPRQLKVP----PYLGY------RFLGEKDCGAPCE-PGKANGLMYFKEEEVRFARLWVG 232

  Fly   323 LWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIAC------D 381
            :|:.||..|||.|:.|:::|..||.||||||:|||.|||||||.| :..||..|...|      |
 Frog   233 IWAILCGISTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAY-TAGFLLEERGVCVERFSED 296

  Fly   382 GLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWL 446
            ........|....||::|::.|||||||||||||||.|||||||:|||:|||..:|||||||||.
 Frog   297 SYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWA 361

  Fly   447 IPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRS 511
            :|.|:::.:|.:..||||.:.|:||||..:.|.|:.||||||||||.|||:||:||||||||||:
 Frog   362 VPAVKTITILAMGQVDGDILSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRT 426

  Fly   512 VIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDW--------IKALA 568
            ::|..     |.|.:||||||:|||:|||:||||||||:.||.||.|:.:.|        .|..|
 Frog   427 IMKHD-----GTKTEKLEKLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGFA 486

  Fly   569 CPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRL 620
            .||.........|.::|.|:||.|.:.|||||..||||||||:|||||:.||
 Frog   487 VPCPNYNFAPMSPDFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRL 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 60/121 (50%)
Frizzled 308..618 CDD:279827 176/324 (54%)
fzd7NP_001016741.1 CRD_FZ7 32..156 CDD:143575 68/204 (33%)
Frizzled 218..536 CDD:279827 176/324 (54%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. {ECO:0000250} 526..531 4/5 (80%)
PDZ-binding. {ECO:0000255} 546..548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.