DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and fzd2

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001008449.1 Gene:fzd2 XenbaseID:XB-GENE-487022 Length:553 Species:Xenopus tropicalis

Alignment Length:620 Identity:267/621 (43%)
Similarity:352/621 (57%) Gaps:133/621 (21%)


  Fly    31 HGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAG 95
            ||..|:.:..||.                    |:.|:||:|..|.||.|..||.:.|..|::||
 Frog    27 HGEKGISVPEHGF--------------------CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAG 71

  Fly    96 LEVHQFWPLVEIKCSPDLKFFLCSMYTPIC--LEDYHKPLPVCRSVCERARSGCAPIMQQYSFEW 158
            ||||||:|||:::||.:|:|||||||.|:|  ||   :.:|.|||:|||||.||..:|.::.|:|
 Frog    72 LEVHQFYPLVKVQCSSELRFFLCSMYAPVCTVLE---QAIPPCRSICERARHGCEALMNKFGFQW 133

  Fly   159 PERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGS 223
            |||:.||:.|.|| .:.:|:                                   |...|..||.
 Frog   134 PERLRCENFPRHG-AEQICV-----------------------------------GQNHSEDGGP 162

  Fly   224 SGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHW--- 285
            :..|::.|..|       .|               .|.|:             ..:.||.|.   
 Frog   163 TLLTTSPPHHG-------TP---------------GPPIY-------------ATLDHPFHCPRV 192

  Fly   286 -----YMNLTVQRIAGVPNCGIPCKGP------FFSNDEKDFAGLWIALWSGLCFCSTLMTLTTF 339
                 |:|   .|..|..:|..||:..      |||.||..||.:||.:||.||..||..|:||:
 Frog   193 LKVPSYLN---YRFLGEKDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTY 254

  Fly   340 IIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACD------GLLLRESSTGPHSCTLV 398
            ::|.:||:||||||:|||.||.||:|.|:: .|:...::.|:      |.......|....||::
 Frog   255 LVDMQRFRYPERPIIFLSGCYTMVSVAYIA-GFVLGNKVVCNENFSEGGYKTVVQGTKKEGCTIL 318

  Fly   399 FLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDG 463
            |::.|||.|||||||||||.|||||||:|||:|||..:|||||||||.:|.|:::.:|.:..:||
 Frog   319 FMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDG 383

  Fly   464 DPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKL 528
            |.:.|:|:||..|.|.|:.||||||||||.|||:||:||||||||||:::|..     |.|.:||
 Frog   384 DLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHD-----GTKTEKL 443

  Fly   529 EKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDW--------IKALACPCAQVKGPGKKPLYSV 585
            |:||:|||:|||||||||||||.||.||.|:.|.|        .|:||.||.....|...|.::|
 Frog   444 ERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQNCKSLAIPCPLQYTPRMTPDFTV 508

  Fly   586 LMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRL 620
            .|:||.|.|.||||||.||||||||.|||:|:.||
 Frog   509 YMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRL 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 61/121 (50%)
Frizzled 308..618 CDD:279827 179/324 (55%)
fzd2NP_001008449.1 CRD_FZ2 36..162 CDD:143573 67/185 (36%)
Frizzled 223..540 CDD:279827 179/323 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.