DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and fz4

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_511068.2 Gene:fz4 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster

Alignment Length:751 Identity:183/752 (24%)
Similarity:280/752 (37%) Gaps:226/752 (30%)


  Fly    57 PKDPNLR-CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSM 120
            |:.|..| ||.|.|.|||.||||.||.||.:.:|.|.:....:..|.||:|..||..||.|||:.
  Fly    38 PEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAA 102

  Fly   121 YTPICLEDYHKPLPV-----CRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQ 180
            |.|:|.    ...||     |||:||..|..|.|::|.:.|.||..:.|:..|...:.:.:||| 
  Fly   103 YVPMCT----PKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCME- 162

  Fly   181 PSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQG 245
                              |.|.....:::|...|..|.|..|..|......|.|           
  Fly   163 ------------------GPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSG----------- 198

  Fly   246 EKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGP-FF 309
                              |.|.                |.|:     |:.....|...|:.. .|
  Fly   199 ------------------LAKS----------------HLYV-----RLPRSGRCAPLCEADILF 224

  Fly   310 SNDEKDFAGLWIALWS----GLCFCSTLMTLTTFIIDTERFKYPE-----RPIVFLSACYFMVAV 365
            :..||..|.:|::.|:    ||...:|:..|.:   |..|....:     .|:::   |:.||.:
  Fly   225 TPAEKHLAEIWVSTWAYAALGLALVATVCLLAS---DGSRLASAKWSRLLSPLIW---CHNMVTL 283

  Fly   366 GYLSRNFLQNEEIAC-------DGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLA 423
            |:..|..:.....||       :..||........||..|||:.|:||||:..||.:|...|   
  Fly   284 GWAVRFMVGRTGTACGTDPQAPNESLLTVDGLSNASCASVFLMRYYFGMAACAWWAVLCLGW--- 345

  Fly   424 AGLKWGNEAITKHS---------------------------------QYFHLAAWLIPTVQSVAV 455
                  :..|.:||                                 .:....||.:|..|:.||
  Fly   346 ------HRDIRRHSPDSKGHVVIPSNFGGSPAKRNSAKTAQQDLTQNNFVCFVAWGLPAFQTSAV 404

  Fly   456 LLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVG 520
            ::...||.|.:||.|:|||.:...|:..|..|:|.|.:.|:..|::|::...|.:.:::....:.
  Fly   405 IVARFVDADELLGACFVGNQSDKALQILVATPVFCYWIFGSMNLISGYLVHCRTKEILRNSNALS 469

  Fly   521 AGVKADKLEKLMIR----IGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKP 581
            .   ..:|::|...    ||||..:|.:...:::...:||.|..:.|:.:         |....|
  Fly   470 V---QQQLQQLSAHSSSGIGIFLFIYGLACAMLLLAVIYEFANIDVWLGS---------GDTNTP 522

  Fly   582 LYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPHPYAG 646
            |:..| |:.||.|.:||....|: .|.::.:..:          |..:|..::|      |..||
  Fly   523 LWPFL-LRAFMELMLGICCFAWV-LGPSISTLYK----------RQVSNGKMVK------HTSAG 569

  Fly   647 SGMGMPVG--SAAGS----------------------LLATPY-------------TQAGGASVA 674
            :..|...|  |:.||                      |..:||             .|....|:.
  Fly   570 AATGHLDGHSSSRGSHAACNSTVVSYHSVRTSMASVPLPPSPYKLKTSPGTGSISLNQMSNYSLG 634

  Fly   675 STSHH------HLHHHVLKQ-----PAASHVXHGES 699
            .:.||      |.|||..:|     |..:|. |..|
  Fly   635 RSVHHQQRHSPHHHHHQQQQHHQFHPHHNHQHHSTS 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 51/125 (41%)
Frizzled 308..618 CDD:279827 86/363 (24%)
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 53/149 (36%)
7tm_4 223..544 CDD:304433 85/349 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119384064
eggNOG 1 0.900 E1_KOG3577
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D237456at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11309
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.