DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and Sfrp5

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001101061.1 Gene:Sfrp5 RGDID:1310369 Length:314 Species:Rattus norvegicus

Alignment Length:172 Identity:60/173 (35%)
Similarity:83/173 (48%) Gaps:29/173 (17%)


  Fly    13 LVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPG--YGVPV----IPKDPNLRCEEITIPM 71
            |.|||      |.||.|.  ..|.....:|....|..|  |..|.    ||.|         :|:
  Rat    12 LALLL------GALHGAP--ARGQEYDYYGWQTEPLHGRSYSKPPQCLDIPAD---------LPL 59

  Fly    72 CRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVC 136
            |..:||.....||.:.||:..|...:...:.||:..:|..|.:.||||::.|:||:   :|:..|
  Rat    60 CHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLD---RPIYPC 121

  Fly   137 RSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCM 178
            ||:||..|:||||:|:.|.|.|||.:.|...||..|   ||:
  Rat   122 RSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDND---LCI 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 43/117 (37%)
Frizzled 308..618 CDD:279827
Sfrp5NP_001101061.1 CRD_SFRP5 44..170 CDD:143553 48/133 (36%)
NTR_Sfrp1_like 175..300 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.