DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and Fzd3

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_703204.1 Gene:Fzd3 RGDID:628814 Length:666 Species:Rattus norvegicus

Alignment Length:690 Identity:222/691 (32%)
Similarity:316/691 (46%) Gaps:164/691 (24%)


  Fly    38 MGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFW 102
            :|||.|                  ..||.||:.||:.:.||.|..||.:||..|..|.|.:..|.
  Rat    20 IGGHSL------------------FSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFH 66

  Fly   103 PLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHL 167
            |:|.:.||.|.:.|||::|.|||:|.....|| ||.:|:||.|.|:.:|:.:...|||.|.|...
  Rat    67 PMVNLDCSRDFRPFLCALYAPICMEYGRVTLP-CRRLCQRAYSECSKLMEMFGVPWPEDMECSRF 130

  Fly   168 P-------------LHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSG 219
            |             |.|||          ||               |:....:|..|        
  Rat   131 PDCDEPYPRLVDLNLVGDP----------TE---------------GAPVAVQRDYG-------- 162

  Fly   220 AGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHH 284
                                                      .:..:|..:........:|    
  Rat   163 ------------------------------------------FWCPRELKIDPDLGYSFLH---- 181

  Fly   285 WYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYP 349
                        |.:|..||...:|..:|..||..:|.|.|.:|..:||:|..||:||..||:||
  Rat   182 ------------VRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLVTFLTFLIDVTRFRYP 234

  Fly   350 ERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGL--LLRESST---GPH--SCTLVFLLTYFFGM 407
            ||||:|.:.||.||::.:.. .||..:.:||:..  ...::||   |.|  :||::|::.|||.|
  Rat   235 ERPIIFYAVCYMMVSLIFFI-GFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTM 298

  Fly   408 ASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYV 472
            |.|:|||||:.||||||..|||:|||.|.:..||.:||.||...::.:|.::.::||.|.|:|:|
  Rat   299 AGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFV 363

  Fly   473 GNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGI 537
            |..:.|.|:.||||||.:|:|:|.:.|:||.:||.|:|..|..:     ....|||.|.|||||:
  Rat   364 GLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLE-----KENQDKLVKFMIRIGV 423

  Fly   538 FSVLYTVPATIVIGCYLYEAAYFEDW--------IKALACPCAQVKGPGKKPLYSVLMLKYFMAL 594
            ||:||.||..:|||||.||.||...|        .:....||........:|...:.::||.|||
  Rat   424 FSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMAL 488

  Fly   595 AVGITSGVWIWSGKTLESWRRFW------------RRLLGAPDRTGANQALIKQ-RPPIPHPYAG 646
            .|||.|..|:.|.||...|..|:            |::|..||..   |:|::. ..||.....|
  Rat   489 IVGIPSIFWVGSKKTCFEWASFFHGRKKKETVNESRQVLQEPDFA---QSLLRDPNTPIIRKSRG 550

  Fly   647 S---GMGMPVGSAAGSLLATPYTQAGGA-SVASTSHHHLH 682
            :   |......|...:::....::||.. |..|:.|..||
  Rat   551 TSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLH 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 50/132 (38%)
Frizzled 308..618 CDD:279827 139/337 (41%)
Fzd3NP_703204.1 CRD_FZ3 24..150 CDD:143558 51/155 (33%)
Frizzled 193..512 CDD:279827 139/325 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.