DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and mom-5

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001300437.1 Gene:mom-5 WormBaseID:WBGene00003397 Length:570 Species:Caenorhabditis elegans

Alignment Length:672 Identity:208/673 (31%)
Similarity:300/673 (45%) Gaps:159/673 (24%)


  Fly    13 LVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGY 77
            |:|.|..|.      |||..:....:       |...|:..       ..:||.||||||:.:.|
 Worm     6 LILFLFGCL------SADQRLSSTSI-------SSMNGFST-------TRKCEHITIPMCKNLDY 50

  Fly    78 NMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPIC--LEDYHKPLPVCRSVC 140
            |.|.|||.:.|.||.|||..:.||.||:::|||.|::.|||::|.|:|  ||   ||:..||.:|
 Worm    51 NQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVCTVLE---KPIQPCRELC 112

  Fly   141 ERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSG 205
            ..|::||..:|:::.|:||:::.|...|:                                    
 Worm   113 LSAKNGCESLMKKFGFQWPDQLDCNKFPV------------------------------------ 141

  Fly   206 GKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLL 270
                                   |..|.|:||....|.:..::|..          :..|...:.
 Worm   142 -----------------------TDLCVGKNSSESSNSKNYRSSND----------VTFGVSTIA 173

  Fly   271 QQQSQMPMM--HHPH-----HWYMNLTVQRIAGVPNCGIPCKGP-----FFSNDEKDFAGLWIAL 323
            .:....|..  ||.|     |:.:.|...|:   |.|.:.|:..     .|....:....:|.|.
 Worm   174 NEVVLSPKKCPHHMHTTSGSHFSLPLLSGRL---PECSLTCEADNQVPMMFDGRVRRILRIWTAA 235

  Fly   324 WSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRES 388
            ||..||..:|.||.||::|..||.||.|||::|:.||..::..|:. ..:..:..|| |......
 Worm   236 WSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMI-GVVGEDGFAC-GTYGSTP 298

  Fly   389 ST-----GPH-SCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLI 447
            :|     |.: .|:.:.::.|||.|:|..||::|...|||||.||||.|:|...|.|||...|.:
 Worm   299 TTLVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGV 363

  Fly   448 PTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSV 512
            |.|.||.||:.::||||...|||.||||||..|..|...|:.|.|.:|...|:.|..|:.||||.
 Worm   364 PAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRIRSY 428

  Fly   513 IK-QQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEA----AYFEDWIKALA---- 568
            || |...|...:  .||||||:|||.|:::|::|..:......|:|    |:.|.|:....    
 Worm   429 IKLQHADVERNI--SKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLEGWLHHRCVRLQ 491

  Fly   569 -------------CPC-AQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRR 619
                         ||. .:|..|.    ..|.:|||...|.||||..:|:.|.|||.|:.:    
 Worm   492 DRELFGFTYPVDDCPMDPKVAAPE----IIVFLLKYVSQLVVGITCAIWVVSSKTLSSYHK---- 548

  Fly   620 LLGAPDRTGANQALIKQRPPIP 641
                     |..||..:.|.:|
 Worm   549 ---------AYLALSSRSPTVP 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 50/121 (41%)
Frizzled 308..618 CDD:279827 126/339 (37%)
mom-5NP_001300437.1 CRD_FZ1_like 35..147 CDD:143567 52/174 (30%)
7tmF_Frizzled_SMO 219..550 CDD:320089 127/352 (36%)
TM helix 1 228..253 CDD:320089 11/25 (44%)
TM helix 2 262..282 CDD:320089 7/21 (33%)
TM helix 3 312..338 CDD:320089 10/26 (38%)
TM helix 4 355..371 CDD:320089 8/16 (50%)
TM helix 5 393..422 CDD:320089 10/29 (34%)
TM helix 6 446..473 CDD:320089 10/27 (37%)
TM helix 7 512..537 CDD:320089 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.