DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and mfrp

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_009289590.1 Gene:mfrp ZFINID:ZDB-GENE-160728-150 Length:572 Species:Danio rerio

Alignment Length:115 Identity:41/116 (35%)
Similarity:59/116 (51%) Gaps:12/116 (10%)


  Fly    64 CEEITIPMCRGIGYNMTSFPN-EMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLE 127
            ||.|.:.|||.:.||:||||| .::...|.||...:|::..||::.|....:..:|.|:.|.|  
Zfish   459 CELIQVEMCRDLSYNLTSFPNIWLSLSDQREAASILHKYRVLVDLPCFESFRQLVCGMFLPRC-- 521

  Fly   128 DYHKP----LPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDP 173
               .|    |.:|:|||..|...|:|.:..:|..||  ..|..||...||
Zfish   522 ---SPQSGVLQLCQSVCSTAELQCSPALSLFSLNWP--FNCLLLPDSHDP 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 41/116 (35%)
Frizzled 308..618 CDD:279827
mfrpXP_009289590.1 CUB 138..248 CDD:238001
LDLa 256..290 CDD:238060
CUB 297..405 CDD:238001
LDLa 413..447 CDD:238060
Fz 459..563 CDD:279700 39/111 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.