DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and LOC101884738

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_005174172.1 Gene:LOC101884738 ID: Length:292 Species:Danio rerio

Alignment Length:137 Identity:49/138 (36%)
Similarity:72/138 (52%) Gaps:16/138 (12%)


  Fly    63 RCEEITIP----MCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTP 123
            ||  :.||    :|:|:||:....||.:.||:..||..:...:.||:..:|.|..:.||||::.|
Zfish    30 RC--VPIPANMALCQGLGYSSMRMPNLLGHESPAEAVQQSTSWLPLLARECHPHARIFLCSLFAP 92

  Fly   124 ICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNL-CMEQPSYTEAG 187
            :|||....|   |||:|...|..|||||..|.:.||..:.|:..|    .|:| |:.  |.....
Zfish    93 VCLERIISP---CRSLCVSVRDSCAPIMNCYGYPWPRILQCDQFP----KDHLMCIS--SVANLQ 148

  Fly   188 SGGSSGG 194
            :|.|:.|
Zfish   149 NGTSNEG 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 45/124 (36%)
Frizzled 308..618 CDD:279827
LOC101884738XP_005174172.1 CRD_FZ 29..166 CDD:295308 49/138 (36%)
NTR_Sfrp1_like 160..290 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.