DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fz2 and fzd4

Sequence 1:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_017947246.1 Gene:fzd4 XenbaseID:XB-GENE-478210 Length:539 Species:Xenopus tropicalis

Alignment Length:656 Identity:241/657 (37%)
Similarity:332/657 (51%) Gaps:162/657 (25%)


  Fly     8 VLILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMC 72
            |..|.|.|.|..|                 :.||      ..|:|     .:...||:.|.|.||
 Frog     3 VRALALCLPLLGC-----------------LVGH------IAGFG-----DEEERRCDPIRISMC 39

  Fly    73 RGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLK----------------FFLCSMY 121
            :.:|||:|..||.:.||.|.:|.|::..|.||::..||..|:                |||||:|
 Frog    40 QNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQVGTCCLAIAPAPAQLLFFLCSVY 104

  Fly   122 TPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEA 186
            .|:|.|..:.|:..|..:|...:..|.|:::::.|.|||.:.|...|...|.:::|||.|...|.
 Frog   105 VPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDDEV 169

  Fly   187 GSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGK 251
                                                        |.   :||....| ||     
 Frog   170 --------------------------------------------PV---HSKTPVLP-GE----- 181

  Fly   252 ECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPC--KGPFFSNDEK 314
              .|:...|    ..:|              :.|     |:|..   ||.:.|  ....:|...|
 Frog   182 --DCNSFGP----NSDQ--------------YTW-----VKRSM---NCVLKCGYDSGLYSRLSK 218

  Fly   315 DFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIA 379
            :|..:|:|:|:.|||.||..|:.||:||:.||.||||||:|||.||.:.::.|:.|..:..|.|:
 Frog   219 EFTDIWMAVWASLCFISTAFTVLTFLIDSSRFCYPERPIIFLSMCYNIYSIAYIVRLTVGRERIS 283

  Fly   380 CD------GLLLRE--SSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKH 436
            ||      .:|::|  .:||   |.::|||.||||||||||||||:.|||||||||||:|||..|
 Frog   284 CDFEEAAEPVLIQEGLKNTG---CAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMH 345

  Fly   437 SQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMA 501
            |.|||:|||.||.|:::.:|::..||.|.:.|:|||||.|.|.|..||:||||.||||||.|:.|
 Frog   346 SSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLFTYLVIGTLFIAA 410

  Fly   502 GFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKA 566
            |.|:||:|||.:::.     |.|.||||:||::||:||||||||||.||.||.||   ..:|   
 Frog   411 GLVALFKIRSNLQKD-----GTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYE---ISNW--- 464

  Fly   567 LACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQ 631
                 ...:........:|.||..||:|.||||||:||||.|||.:|::...||:        |.
 Frog   465 -----NVFRYTADDSNMAVEMLNIFMSLLVGITSGMWIWSAKTLHTWQKCTNRLV--------NS 516

  Fly   632 ALIKQR 637
            ..:|::
 Frog   517 GKVKRK 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 48/135 (36%)
Frizzled 308..618 CDD:279827 163/318 (51%)
fzd4XP_017947246.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D237456at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.