DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and GEMIN2

DIOPT Version :9

Sequence 1:NP_001262034.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_003607.2 Gene:GEMIN2 / 8487 HGNCID:10884 Length:269 Species:Homo sapiens


Alignment Length:261 Identity:76/261 - (29%)
Similarity:113/261 - (43%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKR--SSKI-RNNTGNTTLEMLDN 72
            :|..:|.|:....|||..||.:.:|||..:..|..:||.||..:  ..|: |..:.|.:|.... 
Human    16 RLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQ- 79

  Fly    73 PELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQ 137
               |..:...||.:|:.:||..|...|..|...|....:...|.:...|.:.|:|.||:||..::
Human    80 ---PAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEK 141

  Fly   138 -------------------------PLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWL 177
                                     ||||.:..:.|..:..:||.||.|..:.:.|.:      |
Human   142 LCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPE------L 200

  Fly   178 ARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFK 242
            .|||||.|.||..||.|...|.:|.:||.|..:|..:...:.:|....|||:.|..:.|.|.|..
Human   201 GRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLA 265

  Fly   243 D 243
            |
Human   266 D 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 71/248 (29%)
GEMIN2NP_003607.2 SIP1 34..262 CDD:398549 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160466
Domainoid 1 1.000 101 1.000 Domainoid score I6969
eggNOG 1 0.900 - - E1_28H7D
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37827
Inparanoid 1 1.050 110 1.000 Inparanoid score I4895
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55374
OrthoDB 1 1.010 - - D1235594at2759
OrthoFinder 1 1.000 - - FOG0005780
OrthoInspector 1 1.000 - - oto89573
orthoMCL 1 0.900 - - OOG6_104791
Panther 1 1.100 - - LDO PTHR12794
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4058
SonicParanoid 1 1.000 - - X6261
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.