DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gem2 and AT2G42510

DIOPT Version :9

Sequence 1:NP_001262034.1 Gene:Gem2 / 40087 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001154570.1 Gene:AT2G42510 / 818851 AraportID:AT2G42510 Length:653 Species:Arabidopsis thaliana


Alignment Length:208 Identity:48/208 - (23%)
Similarity:67/208 - (32%) Gaps:67/208 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EPDSSFDPQKPPESGEEYLMHMFYERKRCPAV-VTKRS-SKIRNNTGNTTLEMLDNPELP----- 76
            |||  || ..|||.|.|||..:.:|.||.|.| |.|.| ||.|....:..:     |::|     
plant   458 EPD--FD-SGPPEDGIEYLRRVRWEAKRIPNVKVAKVSGSKYREKEQSVYM-----PQIPRAPAT 514

  Fly    77 --------PFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFC 133
                    .|:.|.     ....:..||.|...|.:|..:...|....:|.....:|....||  
plant   515 GEGMGGLVAFRLLT-----HSSGIPFFQLAYLSVFLLTDKDTRNGLSDTGIKAEKADMFGEKE-- 572

  Fly   134 RNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLPLEPHVFS 198
                      ..|..:|                           .:|:.|....:..|.:....:
plant   573 ----------SGLESSD---------------------------CKWVVALCASVDTPPDADTSA 600

  Fly   199 TLRYIARTCIHLR 211
            .||.:.|.|..||
plant   601 CLRALVRKCASLR 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 48/208 (23%)
AT2G42510NP_001154570.1 SIP1 454..614 CDD:282754 48/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28H7D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1235594at2759
OrthoFinder 1 1.000 - - FOG0005780
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104791
Panther 1 1.100 - - O PTHR12794
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.