DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gem2 and Gemin2

Sequence 1:NP_001262034.1 Gene:Gem2 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_079932.2 Gene:Gemin2 MGIID:1913853 Length:269 Species:Mus musculus

Alignment Length:261 Identity:75/262 (29%)
Similarity:112/262 (43%) Gaps:38/262 (15%)


  Fly    11 QLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKR--SSKI-RNNTGNTTLEMLDN 72
            :|..:|.|:....|||..||.:.:|||..:..|..:||.||..:  ..|: |..:.|.:|.... 
Mouse    16 RLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQ- 79

  Fly    73 PELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQ 137
               |..:...||.:|:.:||..|...|..|...|....:...|.:...|.:.|:|.||:||..::
Mouse    80 ---PAPEGYSPTLQWQQQQVAHFSTVRQSVHKHRNHWKSQQLDSNVAMPKSEDEEGWKKFCLGER 141

  Fly   138 -------------------------PLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWL 177
                                     ||||.:..:.|..:..:||.||.|..:.:.|.:      |
Mouse   142 LCAEGATGPSTEESPGIDYVQVGFPPLLSIVSRMNQTTITSVLEYLSNWFGERDFTPE------L 200

  Fly   178 ARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFK 242
            .||.||.|.||..||.|...|.:|.:||.|..:|..:...:.:|....|||:.|..:.|.|.|..
Mouse   201 GRWFYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVGSKDDERVPALNLLICLVSRYFDQRDLA 265

  Fly   243 D 243
            |
Mouse   266 D 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 71/249 (29%)
Gemin2NP_079932.2 SIP1 22..261 CDD:282754 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C182455773
eggNOG 1 0.900 E1_28H7D
Hieranoid 1 1.000
Homologene 1 1.000 H37827
Inparanoid 1 1.050 109 1.000 Inparanoid score I4857
Isobase 1 0.950 0 Normalized mean entropy S3221
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006552
OrthoInspector 1 1.000 T1085092
orthoMCL 1 0.900 OOG5_132394
Panther 1 1.100 LDO PTHR12794
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4058
TreeFam 1 0.960
1312.830

Return to query results.
Submit another query.