DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gem2 and gemin2

Sequence 1:NP_001262034.1 Gene:Gem2 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001017608.1 Gene:gemin2 ZFINID:ZDB-GENE-030131-3756 Length:253 Species:Danio rerio

Alignment Length:267 Identity:72/268 (27%)
Similarity:112/268 (42%) Gaps:52/268 (19%)


  Fly    11 QLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKR--SSKIRNNTGNTTLE-MLDN 72
            :|..::.|:.: .:...:||.:.:|||..:..|...||.||..:  ..|::..:.|.::. .|..
Zfish     3 RLLPVDSCDTE-EYTLTEPPRNPQEYLRFVQREASLCPDVVVAQIDPKKLKKQSVNVSITGCLAA 66

  Fly    73 PE--LPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRN 135
            ||  .|.||       |:.:||..|...|..|...|:.......|.:...|.|.|::.||.||..
Zfish    67 PEGFSPSFK-------WQQQQVSRFSEVRQSVNKHRQHWKAQFLDDNVVMPKTEDEDGWKRFCLG 124

  Fly   136 QQ-------------------------PLLSTLLHLTQNDLELLLEMLSKWLQD----PNTTVDL 171
            :.                         |.||.:..|:|:.:..:||.|..|.::    |.     
Zfish   125 ENVCLEIQLKEEDGVNPGLDYVKTGFPPFLSIVSKLSQSTVSAVLEYLINWFEERAFVPQ----- 184

  Fly   172 LHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVF 236
                 |.|||||.|.||..||.|...|.:|.:||.|..:|..|:..:..|.:..||::.:..:.|
Zfish   185 -----LGRWLYALLACLEKPLLPEAHSLIRQLARRCSAVRANLESKDDDRLSALNLMICIVARYF 244

  Fly   237 AQNDFKD 243
            .|||..|
Zfish   245 EQNDLAD 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 68/255 (27%)
gemin2NP_001017608.1 SIP1 10..247 CDD:282754 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C182447947
eggNOG 1 0.900 E1_28H7D
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37827
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1235594at2759
OrthoFinder 1 1.000 FOG0006552
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132394
Panther 1 1.100 LDO PTHR12794
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.