DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gem2 and yip11

Sequence 1:NP_001262034.1 Gene:Gem2 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_594775.1 Gene:yip11 PomBaseID:SPAC19B12.12c Length:235 Species:Schizosaccharomyces pombe

Alignment Length:209 Identity:46/210 (22%)
Similarity:86/210 (41%) Gaps:34/210 (16%)


  Fly     6 EDQTFQLQALEICEPDSSFDPQK--PPESGEEYLMHMFYE-RKRCPAVVTKRSSKIRNNTGNTTL 67
            :::|.|..|....:.:|:.:..:  .|..|.:||..:..| ||..|.|..:|..:.|.......|
pombe    19 DEETNQRSAFPQIDNNSASESLEYDIPLDGLDYLATVREEARKLVPFVAARREPETRETIPLRKL 83

  Fly    68 EM-LDNPELPPF-KCLLPTPEWRDEQVKSFQAARS-QVLVLRKELANNNYDQSGEPPLTSDQEKW 129
            |: .......|| :.||...:...|:::.:..:.| ...:|.|.|                 ::|
pombe    84 EIEAGKKSFDPFLRYLLNIIDKEGERLEQYMESSSLDASILPKNL-----------------QQW 131

  Fly   130 KEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLP--L 192
            :.:..::.|..:.|..:....:..:||.||.||:  ...:||     .::|::.  .|..||  |
pombe   132 RVYIEHKAPCWAILAVVDLATVLEILESLSSWLE--KDAIDL-----QSQWIFC--FCYKLPELL 187

  Fly   193 EPHVFSTLRYIART 206
            .....||||.:.::
pombe   188 NGEDISTLRSVLKS 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 43/198 (22%)
yip11NP_594775.1 SIP1 45..208 CDD:282754 42/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12794
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.