DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gem2 and smi-1

Sequence 1:NP_001262034.1 Gene:Gem2 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001022847.1 Gene:smi-1 WormBaseID:WBGene00004886 Length:254 Species:Caenorhabditis elegans

Alignment Length:270 Identity:62/271 (23%)
Similarity:104/271 (38%) Gaps:62/271 (23%)


  Fly    16 EIC-EPDSSF-----DPQKPPESGEEYLMHMFYERKRCPAVV-------------TKRSSKIRNN 61
            |.| .|...|     |...|..|..:||..|..||:....||             .|:..:...:
 Worm     4 EACLGPSDDFEADDVDMTSPAMSAAQYLRQMQAERRGTKNVVRIAQKSPDSTSPEAKKQKQWLES 68

  Fly    62 TGNTTLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQ 126
            .|...::.::.|.  |   |:|:.|||.|:.:.|:..|:::.:..::.:....|:...|    ::
 Worm    69 VGYQEVKKIETPS--P---LIPSEEWRQEKCRKFEETRAKMALKIEKFSPMRIDRLNSP----EE 124

  Fly   127 EKWKEFCRNQ------------------QPLLSTLLHLTQNDLELLLEMLSKW-----LQDPNTT 168
            |:|.|....:                  .|.|..:..:.:..|..|:|.|..|     |..|   
 Worm   125 EEWHEILLEKCLPEFQDIAGNFLNHTGTPPALRMVFSIPKRHLSQLIEYLVDWSIEEGLNRP--- 186

  Fly   169 VDLLHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTV 233
                    :..|:|:.|..:.|||...|.|.||.:.:.|..||::|..|....|..::|.:|:..
 Worm   187 --------IREWIYSLLAVIDLPLVQDVVSALRRLVKECRSLRSELSIDRKSEANEFSLFITIIT 243

  Fly   234 QVFAQNDFKD 243
            ..|.|.|..|
 Worm   244 IFFGQKDLAD 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 59/263 (22%)
smi-1NP_001022847.1 SIP1 14..249 CDD:282754 56/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181796671
eggNOG 1 0.900 E1_28H7D
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I3889
Isobase 1 0.950 0 Normalized mean entropy S3221
OMA 1 1.010
OrthoDB 1 1.010 D1235594at2759
OrthoFinder 1 1.000 FOG0006552
OrthoInspector 1 1.000 T474294
orthoMCL 1 0.900 OOG5_132394
Panther 1 1.100 LDO PTHR12794
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4058
TreeFam 1 0.960
1312.840

Return to query results.
Submit another query.