DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and ZMYND15

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001254751.1 Gene:ZMYND15 / 84225 HGNCID:20997 Length:750 Species:Homo sapiens

Alignment Length:177 Identity:39/177 - (22%)
Similarity:51/177 - (28%) Gaps:91/177 - (51%)


  Fly    39 KKGHRSEC-----QCFEIATNE---VLGRHL---------------------------------- 61
            :||.|||.     .|..:.|:|   :||..|                                  
Human   192 RKGQRSEAAPLHVSCLLLVTDEHGTILGIDLLVDGAQGTASWGSGTKDLAPWAYALLCHSMACPM 256

  Fly    62 -----RATRDIKIGEQILKE--APLV--LGPKVASAPL------------------CLGCHRN-- 97
                 |..|.:.:|:..|..  ..||  ||.|:|..|:                  |..|||:  
Human   257 GSGDPRKPRQLTVGDARLHRELESLVPRLGVKLAKTPMRTWGPRPGFTFASLRARTCHVCHRHSF 321

  Fly    98 --LLAPGKPRGNYHKCSSCSWPL-CG--------KECEDSVHHKAEC 133
              .|.|         |..||..| ||        :.|.|.|.|:..|
Human   322 EAKLTP---------CPQCSAVLYCGEACLRADWQRCPDDVSHRFWC 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 4/6 (67%)
SET <246..291 CDD:214614
ZMYND15NP_001254751.1 zf-MYND 313..359 CDD:280009 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.