DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd3

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_081464.1 Gene:Smyd3 / 69726 MGIID:1916976 Length:428 Species:Mus musculus

Alignment Length:458 Identity:106/458 - (23%)
Similarity:173/458 - (37%) Gaps:150/458 - (32%)


  Fly    58 GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLG-----CHRNLLAPGKPRGNYHKCSSCS-W 116
            |..|||...::.||.:.:..||       :..:|.|     |.|.||  ||.:  ..:||.|. .
Mouse    15 GNGLRAVAPLRPGELLFRSDPL-------AYTVCKGSRGVVCDRCLL--GKEK--LMRCSQCRIA 68

  Fly   117 PLCGKECEDSV--HHKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLR-CMHLKDKDPDAF 178
            ..|..:|:...  .|:.||..:.    ..|..|.|..         |.:|.| .:.|.|:.|...
Mouse    69 KYCSAKCQKKAWPDHRRECSCLK----SCKPRYPPDS---------VRLLGRVIVKLMDEKPSES 120

  Fly   179 LKL---YNLEDHLKERLETPLYQVLRANLITF-------IKTVLGMKDWPEMDILRIAAILDTNT 233
            .||   |:||.:: .:|.....:.||...:||       |:....:.  |..|:....|.:..|:
Mouse   121 EKLYSFYDLESNI-SKLTEDKKEGLRQLAMTFQHFMREEIQDASQLP--PSFDLFEAFAKVICNS 182

  Fly   234 FEVRQPRERRKIRALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRST 298
            |.:.....:.....|||..::::|.|.||....|:.. :::..|.|:|..||.|:|.|...|.::
Mouse   183 FTICNAEMQEVGVGLYPSMSLLNHSCDPNCSIVFNGP-HLLLRAVREIEAGEELTICYLDMLMTS 246

  Fly   299 IQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKAGKIISLNPLLNSAPWKCQLCNFKRS 363
            .:||..||...||:|.|.|||..::                                        
Mouse   247 EERRKQLRDQYCFECDCIRCQTQDK---------------------------------------- 271

  Fly   364 AKDVVTSDAELQQEL-ESLDKTTPVALEEFIYRHRADLHETNTHILQAKYALTQLYGSAPGFAME 427
            ..|::|.|.::.:|: |||.|     :||                |:|.:...|:          
Mouse   272 DADMLTGDEQIWKEVQESLKK-----IEE----------------LKAHWKWEQV---------- 305

  Fly   428 ELSGESLNRKLQLCEELL-----KLADIFDGGWSIFRGNLL---ID-------MEEALVTQALRS 477
                      |.||:.::     :|.||     :|::..:|   :|       :||||. .|:|:
Mouse   306 ----------LALCQAIINSNSNRLPDI-----NIYQLKVLDCAMDACINLGMLEEALF-YAMRT 354

  Fly   478 KDP 480
            .:|
Mouse   355 MEP 357

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 15/44 (34%)