DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and SMYD3

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001161212.1 Gene:SMYD3 / 64754 HGNCID:15513 Length:428 Species:Homo sapiens

Alignment Length:340 Identity:87/340 - (25%)
Similarity:141/340 - (41%) Gaps:60/340 - (17%)


  Fly    58 GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLG-----CHRNLLAPGKPRGNYHKCSSCS-W 116
            |..|||...::.||.:.:..||       :..:|.|     |.|.||  ||.:  ..:||.|. .
Human    15 GNGLRAVTPLRPGELLFRSDPL-------AYTVCKGSRGVVCDRCLL--GKEK--LMRCSQCRVA 68

  Fly   117 PLCGKECEDSV--HHKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCM-HLKDKDPDAF 178
            ..|..:|:...  .||.||:.:.    ..|..|.|..         |.:|.|.: .|.|..|...
Human    69 KYCSAKCQKKAWPDHKRECKCLK----SCKPRYPPDS---------VRLLGRVVFKLMDGAPSES 120

  Fly   179 LKL---YNLEDHLKERLETPLYQVLRANLITF-------IKTVLGMKDWPEMDILRIAAILDTNT 233
            .||   |:||.:: .:|.....:.||..::||       |:....:.  |..|:....|.:..|:
Human   121 EKLYSFYDLESNI-NKLTEDKKEGLRQLVMTFQHFMREEIQDASQLP--PAFDLFEAFAKVICNS 182

  Fly   234 FEVRQPRERRKIRALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRST 298
            |.:.....:.....|||..::::|.|.||....|:.. :::..|.|.|..||.|:|.|...|.::
Human   183 FTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGP-HLLLRAVRDIEVGEELTICYLDMLMTS 246

  Fly   299 IQRRVHLRQAKCFDCSCARCQ-DPEELGSFAGAQTCLKCKAGKIISLNPLLNSAPWKCQ----LC 358
            .:||..||...||:|.|.||| ..::.....|.:...|.....:..:..|  .|.||.:    :|
Human   247 EERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEEL--KAHWKWEQVLAMC 309

  Fly   359 NFKRSAKDVVTSDAE 373
                  :.:::|::|
Human   310 ------QAIISSNSE 318

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 15/44 (34%)