DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and SMYD2

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_064582.2 Gene:SMYD2 / 56950 HGNCID:20982 Length:433 Species:Homo sapiens

Alignment Length:420 Identity:95/420 - (22%)
Similarity:164/420 - (39%) Gaps:100/420 - (23%)


  Fly    58 GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNY-----------HKC 111
            ||.|||.:..::|:.:.            |.|    .:..:|...: |||:           .||
Human    18 GRGLRALQPFQVGDLLF------------SCP----AYAYVLTVNE-RGNHCEYCFTRKEGLSKC 65

  Fly   112 SSCSWPL-CGKEC--EDSVHHKAEC--QLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLK 171
            ..|.... |..||  ||...||.||  .::.|.|:.      |.|..|..:.   |:..:.:|.:
Human    66 GRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWN------PSETVRLTAR---ILAKQKIHPE 121

  Fly   172 DKDPDAFLKLYNLEDHLKERLETPLYQVLRANLIT---FIKTVLGMKDWPEMDILRIA-AILDTN 232
            ....:..|.:...|.|| ::|:.....::::::..   |....||   :|:.|.|.:. |.::.|
Human   122 RTPSEKLLAVKEFESHL-DKLDNEKKDLIQSDIAALHHFYSKHLG---FPDNDSLVVLFAQVNCN 182

  Fly   233 TFEVRQPRERRKIRALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRS 297
            .|.:..........|::|..|:::|.|.||:...:...:..| .|.::|..||.:..||...|..
Human   183 GFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEV-RAVQEIKPGEEVFTSYIDLLYP 246

  Fly   298 TIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKAGKIISLNPLLNSAPWKCQ-LCNFK 361
            |..|...||.:..|.|.|..|...:            |.||.  :.:..|  |.|.|.: :.:..
Human   247 TEDRNDRLRDSYFFTCECQECTTKD------------KDKAK--VEIRKL--SDPPKAEAIRDMV 295

  Fly   362 RSAKDVV---------TSDAELQQELE-SLDKTTPVALEEFIYRHRADLHETNTHILQAKYALTQ 416
            |.|::|:         .|.:||.:..| |.:|.:.|            ..::|.::|...|   |
Human   296 RYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSV------------FEDSNVYMLHMMY---Q 345

  Fly   417 LYGSAPGFAMEELSGESLNRKLQLCEELLK 446
            ..|..  ..|::..|     .||..::::|
Human   346 AMGVC--LYMQDWEG-----ALQYGQKIIK 368

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 12/44 (27%)