DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and SmydA-1

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster

Alignment Length:526 Identity:148/526 - (28%)
Similarity:243/526 - (46%) Gaps:28/526 - (5%)


  Fly     6 LTSCALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVLGRHLRATRDIKIG 70
            :..|.:|:......|:.|..|.|||.:|||:.||. |:..|..|:||.||.|||||.|||.||..
  Fly     1 MNPCHVCEEPTKNKCSNCNQVSYCSVQHQKQDWKV-HKPSCHPFKIAHNEQLGRHLVATRTIKPY 64

  Fly    71 EQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWPLCGKECEDSVHHKAECQL 135
            |.:|||||||.||...|||:||||...:.|.     ::.:|..|.|||||.||:....|||||.|
  Fly    65 EIVLKEAPLVRGPAQISAPVCLGCLNGIEAE-----DHIECEQCGWPLCGPECKSLDEHKAECGL 124

  Fly   136 MSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDAFLKLYNLEDHLKERLETPLYQVL 200
            ......:..:....|    ....|..:..:||:.:.:...:...|..:||.....|..:..::..
  Fly   125 TKDRGQKVNVQEFGG----PHPLYTCLSTVRCLLIGETSTEKASKFQDLESLESTRRGSNQWKAD 185

  Fly   201 RANLITFIKTVLGMKDWPEMDILRIAAILDTNTFEVRQPRERRKIRALYPGAAMISHDCVPNMRH 265
            ..::..||......:.:.|.:|::....|..|..||  |.......|::..|:...:.|:||:..
  Fly   186 LVSIGQFIPKFFKTQKFTEEEIMKAVGALQINGHEV--PTTDPSHVAVFYTASFTENSCLPNLAK 248

  Fly   266 RFDDDMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGA 330
            .|:.:.:.:..|.|:|.|...|||.|:..:..|..|:.||.|.|.|.|:|.||.|..||.:...|
  Fly   249 SFNKNGHCILWAPREIKKNAHLSICYSDAMWGTADRQRHLMQTKLFKCACERCVDVTELDTNYSA 313

  Fly   331 QTCLKCK----AGKIISLNPLLNSAPWKCQLCNFKRSAKDVVTSDAE-LQQELESLDKTTPVALE 390
               :||:    .|.::.......:..|:|:.|: |:..|..|....| ..::::|::|.....| 
  Fly   314 ---IKCEDRQCGGLMLPTKADEWNGSWRCRECH-KQVQKHYVERILERAGKDIQSMEKIAENGL- 373

  Fly   391 EFIYRHRADLHETNTHILQAKYALTQLYGSAPGFAMEELSGESLNRKLQLCEELLKLADIFDGGW 455
            :::..:...|...:.|:.:.|..|.||........| .:..:.|..||....||::|.:......
  Fly   374 KYLKHYEKWLPPQHFHMSEIKILLVQLLAKDQKELM-VIPDDRLLLKLNFARELVELYEKLTPCE 437

  Fly   456 SIFRGNLLIDMEEALVTQALR--SKDPLDCEEKLRNAAEMLREIRNIMKHEPEMQQLLLERQVIL 518
            ....|.|..::..|:..|..|  .:..|..:::|..:...:.:..|.:|:|.:   :.:|..|:.
  Fly   438 VRTLGTLCFELHSAIAEQTRRVALETSLSPKDRLEESLFYVDKCVNYLKYESD---IFIEGHVLK 499

  Fly   519 SSALER 524
            .:.:.|
  Fly   500 QAKINR 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 14/36 (39%)
SET <246..291 CDD:214614 13/44 (30%)
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009 14/36 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1845
Isobase 1 0.950 0 Normalized mean entropy S4564
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.