DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-2 and Smyd4-1

Sequence 1:NP_649084.1 Gene:SmydA-2 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster

Alignment Length:537 Identity:111/538 (21%)
Similarity:195/538 (36%) Gaps:121/538 (22%)


  Fly    10 ALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIATN-----------------EVL 57
            |.|..|..::.:...::.|..:...||.:::......|..|:..|                 |:|
  Fly   155 AFCAWKLKKIASLEEHLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEIL 219

  Fly    58 ------GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSW 116
                  ||::.|...|..|..|..|......| :....:|..|...|::...|      |.:|..
  Fly   220 TDPGPRGRYMVAKEAISKGNVIFSERASCFVP-LEQLLICQQCAATLMSAPIP------CPNCHQ 277

  Fly   117 PL--CGKECED--SVHHKAEC--------QLMSGSNFQSK--INYVPG-EEERKESAYCVIMLLR 166
            .:  |.::|.:  |..||.||        :|:..|:...:  :.|:|. ....:|......|...
  Fly   278 RVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEE 342

  Fly   167 CMHLKDKDPDA-----FLKLYNLEDHLKERLETPL-YQVLRANLI------------TFIKTVLG 213
            .|:|..|..::     :|:...:...|.:.::..| |.:|.|||:            .|......
  Fly   343 IMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPAS 407

  Fly   214 MKDWP---EMDILRIAAILDTN---------------TFEVRQPRERRKIRAL------------ 248
            ::||.   ...|||.|..|..|               .|.:.||...:|.|.|            
  Fly   408 IEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSD 472

  Fly   249 ------YPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRST--IQRRVHL 305
                  .|..::.:|.|.|::|.:| |..::|..|.:.|.:||.:...||...|::  :||...|
  Fly   473 PITAINLPYLSLCNHACEPSIRTKF-DGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPL 536

  Fly   306 RQAKCFDCSCARC--QDPEELGSFAGAQTCLK--CKAGKIISLNPLLNSAPWKCQLCNFKRSAKD 366
            :....|:|:||:|  .||::.........|.|  |:...:.......|:..|..: ||.::....
  Fly   537 KAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLR-CNAEKPITC 600

  Fly   367 VVTSDAELQ------QELESLDKTTPVALEEFIYRHRADL------HETNTHILQAKYALTQLYG 419
            .|..  |||      :.|..:..:...:..:.:::...||      |.:...|:..:......|.
  Fly   601 TVCH--ELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTACFYE 663

  Fly   420 SAPGFAMEELSGESLNR 436
            ...|.:::|...|.|.|
  Fly   664 IDGGTSLDEFEYEDLAR 680

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 6/36 (17%)
SET <246..291 CDD:214614 14/63 (22%)
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/46 (26%)
SET <447..526 CDD:214614 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.