DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and SmydA-5

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster

Alignment Length:546 Identity:169/546 - (30%)
Similarity:258/546 - (47%) Gaps:75/546 - (13%)


  Fly     5 SLTSCALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVLGRHLRATRDIKI 69
            |.|.|.:|...|||.|..|:.|.||.|||||:||.: |:..|:.|....:..|||:|:.|::|..
  Fly     3 SSTECPVCGVAASQACTRCKMVRYCDREHQKQHWPQ-HKRRCRPFSEEQDAELGRYLKVTQNIAA 66

  Fly    70 GEQILKEAPLVLGP--------KVASAPLCLGCHRNLLAP---GKPRGNYHKCSSCSWPLCGKEC 123
            |:.:..|.|||:||        |.||...|:||:    .|   ||     |:|..|.||:|...|
  Fly    67 GQIVFIEEPLVVGPKWYLSDADKEASNVPCVGCY----TPCRLGK-----HQCRRCRWPVCSAGC 122

  Fly   124 EDSVHHKAECQLM---SGS----NFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDAFLKL 181
            :   |...||.::   |||    :.:|..:|..|:         .:::|:|:.|:.:.|..:..|
  Fly   123 K---HESMECSVLSLGSGSPTRADARSLNDYFRGD---------ALLVLKCLLLQRQSPTKWSAL 175

  Fly   182 YNLEDHLKERLETPLYQVLRANLITFIK---------------TVLGMKDWPEMDILRIAAILDT 231
            ..::.|.:||..|.||:.....::|:::               |..|    ||| :.|:..|::|
  Fly   176 LEMQSHEEERKGTDLYEEAEKRVVTYLQKRFLCRLKQTNPNLLTDCG----PEM-LHRLCGIIET 235

  Fly   232 NTFEVRQPRERRKIRALYPGAAMISHDCVPNMRHRFDD-DMNIVFLAKRKIAKGEILSISYTQPL 295
            |...:..| ...::..|:..|.|:.|.|.||...:||: ...:...|...:.||:.|.|:||..|
  Fly   236 NFMVIELP-SGVELSGLFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRKGDHLRITYTNIL 299

  Fly   296 RSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCL-----KCKAGKIISLNPLLNSAPWKC 355
            ..|..|:.|||..|.|.|.|:||.||.|.|::..|.|||     .| .|..:.::||..:..|||
  Fly   300 WGTQLRQHHLRLTKHFSCRCSRCLDPTEYGTYISALTCLGDVNQTC-GGTHLPVDPLDENTQWKC 363

  Fly   356 QLCNFKRSAKDVVTSDAELQQELESLDKTTPVA--LEEFIYRHRADLHETNTHILQAKYALTQLY 418
            ..|........|....:.:.:::|.|....|.|  :|..:.|....||..:.|....|:.|.|||
  Fly   364 DTCPMIVDGAYVAELQSHMTEQVEGLLAGCPSANQVELLLARLTHMLHPNHFHTFNLKHTLIQLY 428

  Fly   419 GSAPGFAMEELSGESLNRKLQLCEELLKLA---DIFDGGWSIFRGNLLIDMEEALVTQALRSKDP 480
            |:..|..:..||...|.|||:||.||..:.   |.:....:|:...:||::...|..||.|:  |
  Fly   429 GNEAGLELGVLSNTQLERKLRLCGELYNVCRRLDPYSIKLAIYVTVILIEVAHTLQEQARRA--P 491

  Fly   481 LDCEEKLRNAAEMLREIRNIMKHEPE 506
            .:....|..|...|||...:::.|.|
  Fly   492 AEGTSLLGLAQSRLREAHMVLEKEQE 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 18/36 (50%)
SET <246..291 CDD:214614 14/45 (31%)
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 18/36 (50%)
SET 185..295 CDD:279228 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1845
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.