DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd4

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001099280.1 Gene:Smyd4 / 287525 RGDID:1307369 Length:801 Species:Rattus norvegicus

Alignment Length:611 Identity:132/611 - (21%)
Similarity:212/611 - (34%) Gaps:183/611 - (29%)


  Fly    51 IATNEVLGRHLRATRDIKIGEQILKEAPL--VLGP----------------KVASAPL-CLGCHR 96
            :.|:.:.||||.||:||..||.::||...  ||.|                :|.||.| |..|.|
  Rat   237 LCTDPLKGRHLVATKDILPGELLVKEDAFVSVLNPGEMPPLRHCLENKWDTRVTSADLYCHRCLR 301

  Fly    97 NLLA--PGKPRGNYHKCSSCSW-PLCGKECEDSV---HHKAECQ--------------------- 134
            :.||  |         |..||: ..|.:||....   :|..||.                     
  Rat   302 HTLATVP---------CGGCSYAKYCSQECVQQAWDHYHSTECSLGGLLLTLGVFCHVALRMTLL 357

  Fly   135 -----------------------LMSGSNFQSKINYVPGEEERKESAYCVIMLLRC-MHLK-DKD 174
                                   |....:......|....|..:.|..|...:..| ::.| :.:
  Rat   358 ARFEDVDRVIRMICDKTGRKDTCLPESKDLVKTFGYTNQGESEENSETCEPSIPGCNVNGKYENN 422

  Fly   175 PDAFLKLY-NLEDHLKER--------------------------LETPLYQVLRANLITFIKTVL 212
            .||.|.|. :.|.|..|.                          |::|..:.:...|.|.: ||.
  Rat   423 YDAVLSLLPHTEKHSPEHKFICAVSVSALCRQLKATSLQAQTTGLKSPRLKAVTPGLCTDL-TVW 486

  Fly   213 GMKDWPEMDILR-----IAAILDTNTFE--VRQPRERRKIRALYPGAAMISHDCVPNMRHRFDDD 270
            |:.....|..|:     |.:|....:.|  :...|:.|....::|..::::|.|.||....|...
  Rat   487 GVAMLQHMLQLQCNAQAITSICYAGSKESIITNSRQVRLATGVFPVVSLLNHSCSPNTSVSFTST 551

  Fly   271 MNIVFLAKRKIAKG-EILSISYTQPLRSTI-QRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTC 333
            :..: .|.::|||| |||........|..: :|:..|.....|||||..|.......:.|.....
  Rat   552 VATI-RAAQQIAKGQEILHCYGPHESRMGVAERQQRLSSQYFFDCSCPACHAETLRAAVAPRWEA 615

  Fly   334 LKCKAGKIISLNPLLNSAPWKC--QLCNFKRSAKDVVTSDAELQQELESLDK-----TTPVALEE 391
            ..|...::    |:..:....|  :.|....|...:|:...:|||::.:..|     ....|:::
  Rat   616 FCCNTCRV----PMQGNDVLSCSNESCTNSVSRDRLVSRLQDLQQQVHTAQKLLRSDRPEQAIQQ 676

  Fly   392 FIYRHRAD---LHETNTHILQAKYALTQLYGSAPGFAMEELSGESLNRKLQLCE----------- 442
            .:...||.   |...:|.:.:.:..|.|.|.:...:..   |...:.:.||:.|           
  Rat   677 LLECQRAAENFLSAEHTVLGEIEDGLAQAYATLGDWRQ---SAAHVQKSLQVVEARHGPSSVEIG 738

  Fly   443 -ELLKLADIFDGGWSIFRGNLLIDMEEALVTQALRSKDPLDCEEKLRNAAEMLREIRNIMKH--- 503
             ||.|||.:      :|.|   :.:.|||        |.:...||:            ::.|   
  Rat   739 HELFKLAQV------LFNG---LAVPEAL--------DAIWKAEKI------------LLVHCGP 774

  Fly   504 -EPEMQQLLLERQVILSSALERFEPV 528
             ..|:|:|...|..:|.|:   |.||
  Rat   775 ESDEVQELREMRSCLLDSS---FTPV 797

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 14/45 (31%)
Smyd4NP_001099280.1 TPR_11 68..132 CDD:290150
TPR repeat 68..96 CDD:276809
TPR repeat 101..136 CDD:276809
zf-MYND 296..335 CDD:280009 13/47 (28%)
SET <526..572 CDD:279228 14/46 (30%)
TPR_12 692..>748 CDD:290160 13/64 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.