DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd5

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_659167.2 Gene:Smyd5 / 232187 MGIID:108048 Length:416 Species:Mus musculus

Alignment Length:369 Identity:86/369 - (23%)
Similarity:139/369 - (37%) Gaps:111/369 - (30%)


  Fly    54 NEVLGRHLRATRDIKIGEQILKEAPLVLGPKVASA----PLCLGCHRNL--------LAPGKP-- 104
            :.:.|:.|.||:.|:.||.|..|.|||....:.:|    ..|..|.|.|        ...|||  
Mouse    29 DSIKGKGLFATQLIRKGETIFIERPLVAAQFLWNALYQYRACDHCLRALEKAEENAQRLTGKPSQ 93

  Fly   105 ----------RGNYHK-CSSCSWPLCGKECEDSVHHKAECQLMSGSNFQSK------------IN 146
                      |.:.|: |..|....|..||..:...:....|..|.:...:            ::
Mouse    94 ILPHPELCSVRKDLHQNCPHCQVMYCSAECRLAAAEQYHQILCPGPSHDPRHPLNKLQEAWRSVH 158

  Fly   147 YVPGEEERKESAYCVIMLLRCMHLKD-KDPDAFLKLYNLEDHLKERL----ETPLYQVLRANLIT 206
            |.|      |:|..::|......:|. ||.|.:::|:|   |...|.    :..::::|:.....
Mouse   159 YPP------ETASIMLMARMVATVKQAKDKDHWVRLFN---HFCSRTANQEQAIVHKLLKGKFKD 214

  Fly   207 FIKTVLGM-KD---------W--PEMDILRIAAILDTN-----TFEVRQ-----------PRERR 243
            .::.:||: |:         |  || ....:.|::.||     |..:.|           |::|.
Mouse   215 QLELLLGLFKEALYEEALSLWFTPE-GFRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQDRE 278

  Fly   244 K----IRALY-------------PGAAMI------SHDCVPNMRHRFDDDMNIVFL-AKRKIAKG 284
            :    |..||             .|:.:.      :|.||||....|.::..::.: |...|..|
Mouse   279 QLDTFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFVLHVTALEDIKPG 343

  Fly   285 EILSISY---TQPLRSTIQRRVHLRQAKCFDCSCARC----QDP 321
            |.:.|||   .|..||...|...||:...|:|||.:|    .||
Mouse   344 EEICISYLDCCQRERSRHSRHKILRENYLFNCSCPKCLAEADDP 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 14/64 (22%)
Smyd5NP_659167.2 SET <297..350 CDD:214614 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.