DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd2

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_081072.1 Gene:Smyd2 / 226830 MGIID:1915889 Length:433 Species:Mus musculus

Alignment Length:380 Identity:86/380 - (22%)
Similarity:144/380 - (37%) Gaps:78/380 - (20%)


  Fly    58 GRHLRATRDIKIGEQILKEAP-----LVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWP 117
            ||.|||.|...:|: :|...|     |.:|.:......|......|          .||..|...
Mouse    18 GRGLRALRPFHVGD-LLFSCPAYACVLTVGERGHHCECCFARKEGL----------SKCGRCKQA 71

  Fly   118 L-CGKEC--EDSVHHKAECQLM--SGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDA 177
            . |..||  ||...||.||..|  .|.|:.      |.|..|..:.   |:..:.:|.:....:.
Mouse    72 FYCDVECQKEDWPLHKLECSSMVVLGENWN------PSETVRLTAR---ILAKQKIHPERTPSEK 127

  Fly   178 FLKLYNLEDHLKERLETPLYQVLRANLIT---FIKTVLGMKDWPEMDILRIAAILDTNTFEVRQP 239
            .|.:...|.|| ::|:.....::::::..   |....|...|...:.:|  .|.::.|.|.:...
Mouse   128 LLAVREFESHL-DKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVL--FAQVNCNGFTIEDE 189

  Fly   240 RERRKIRALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVH 304
            .......|::|..|:::|.|.||:...:...:..| .|.::|..|:.:..||...|..|..|...
Mouse   190 ELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEV-RAVQEIHPGDEVFTSYIDLLYPTEDRNDR 253

  Fly   305 LRQAKCFDCSCARC--QDPEELGSFAGAQTCLKCKAGKIISLNPLLNSAPWKCQLCNFKRSAKDV 367
            ||.:..|.|.|..|  :|.::          .|.:..|       |:|.|....:.:..|.|::|
Mouse   254 LRDSYFFTCECRECTTKDKDK----------AKVEVRK-------LSSPPQAEAIRDMVRYARNV 301

  Fly   368 V---------TSDAELQQELE-SLDKTTPVALEEFIYRHRADLHETNTHILQAKY 412
            :         .|.:||.:..| |.:|.:.|            ..::|.::|...|
Mouse   302 IEEFRRAKHYKSPSELLEICELSQEKMSSV------------FEDSNVYMLHMMY 344

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 11/44 (25%)