DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and set-30

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_508850.2 Gene:set-30 / 180772 WormBaseID:WBGene00022499 Length:560 Species:Caenorhabditis elegans

Alignment Length:563 Identity:123/563 - (21%)
Similarity:189/563 - (33%) Gaps:193/563 - (34%)


  Fly    76 EAPL-VLG-PKVASAP----------------------LCLGCHRNLLAPGKPRGNYHKCSSCS- 115
            :||| |:| .|:.|.|                      .|||.:..|           .|..|. 
 Worm     5 DAPLEVVGVEKIGSKPRSKEFYPFAYSLLDCTKDDYCWTCLGENVEL-----------TCEQCKV 58

  Fly   116 WPLCGKECEDS--VHHKAECQLMSGSNFQSKINYVP--GEEERKESAYCVIMLLRC------MHL 170
            ...|.|:||.|  :.||.||         ..:...|  ..:||        ||:|.      :|.
 Worm    59 AKFCSKQCETSGAIDHKYEC---------GPLKKCPDLNTDER--------MLIRIVGRYKDIHS 106

  Fly   171 -KDKDPDAFLKLYNLEDHLKERLETPLYQVLRANLITFIKTVLGMKDWPE-MDILRIAAILDTN- 232
             |||..|.|   ||..:..:..:|      :..:.....|....||.:.: .|  |:....||| 
 Worm   107 GKDKSIDGF---YNNRESKRSVME------IWEHCADMKKDENAMKSFKKTYD--RVKQFGDTNH 160

  Fly   233 ------TFEV--RQPRERRKI----------RALYPGAAMISHDCVPN-----------MRHRFD 268
                  ||::  |....|..|          :.||.......|.|.||           :|...|
 Worm   161 LMDEEVTFQLHSRNFINRHSISNVDYLREIGKGLYLDLCKYDHSCRPNAIYSCNGIVAKLRALHD 225

  Fly   269 D-DMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQT 332
            : |:..|          |....:|.:.....||||..|::...|:|.|.||.||::  ::..:..
 Worm   226 NVDLENV----------ETTHYTYIELPPCKIQRRHMLKETWYFECHCERCDDPDD--NWLTSVL 278

  Fly   333 CLKC----KAGKIISL-------NPLLNSAPWKCQLCNFKRSAKDVVTSDAE-----------LQ 375
            |..|    :..|.|.|       ||  .:....|..|:        .|.|.|           ::
 Worm   279 CPVCISKTEYRKTIKLHGPEAYANP--ETLEIVCDRCS--------TTLDREYIFMALDGMRTIR 333

  Fly   376 QELESLDKTT--PVALEEFIYRHRADLHE-----TNTHILQAKYALTQLYGSAPGFAMEELSGES 433
            :.:|..:..|  |:.|.: ||:.....:|     :|.:..|...|:..|. |......:|....|
 Worm   334 RTVEGAEDETKDPIELLK-IYQGALMTYERILPMSNAYFCQLIAAMIPLI-SRVSMTKKERLVAS 396

  Fly   434 LNRKLQLCEEL-----------------------LKLADIFDGGWSIFRGNLLID----MEEALV 471
            |:..|: ||..                       |:||:..|....:...:.::|    .:..|.
 Worm   397 LDLHLK-CETFVRYVYRHAHPSKAMHFLQMGQLHLELANDKDAARCLIEAHRIMDYLFGADHFLS 460

  Fly   472 TQALRSKDPLDCEEKLRNAAEMLREIRNIMKHEPEMQQLLLER 514
            .|   :|..:|  ..|.:..:..|...|::...||.:|.|.||
 Worm   461 KQ---TKGFMD--HALSSLMQFQRNFVNVLDRVPEAKQALEER 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 11/56 (20%)
set-30NP_508850.2 zf-MYND 41..78 CDD:280009 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.