DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and set-18

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_871849.1 Gene:set-18 / 172949 WormBaseID:WBGene00044070 Length:507 Species:Caenorhabditis elegans

Alignment Length:552 Identity:123/552 - (22%)
Similarity:202/552 - (36%) Gaps:158/552 - (28%)


  Fly    51 IATNEVLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCS 115
            :..:|:...|.|    |||.|...  |..||.|||:.  .|..|.|. .|||:   ...:|..|:
 Worm    17 VQKDEISSIHAR----IKIFETPF--ATQVLNPKVSE--FCANCLRG-PAPGE---KLLRCGGCN 69

  Fly   116 WPL-CGKECEDS--VHHKAECQLMSGS---------NFQSKI-----------NYVPGEEERKES 157
            :.: |.|||:.:  :.||.||:.:..|         .|.||:           :.:..|.|||.|
 Worm    70 FSMYCSKECQATAWLVHKPECKRLKASFPNLPLTEVLFLSKVIDRIQFLEKNGDKLGIEAERKFS 134

  Fly   158 AYCVIMLLRCMHLKDKDPDAFLKLYNLEDHLKERLETPLYQVLRANLITFIKTVLGMKDWPEM-- 220
            :    ::...:.::|.:.    |:.:.|...::                     :|.....||  
 Worm   135 S----LVDHKVDIRDDEE----KMAHFEKIFEK---------------------MGAFRGEEMIE 170

  Fly   221 -----DILRIAAILDTNTFEVRQPRERRKIRALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRK 280
                 |:...|.|   |:..:..........||..|.:..:|.|.|.....||.    ..:..|.
 Worm   171 KGEFFDVFCKATI---NSHSIHTNAGNEVGMALDLGVSKYNHSCRPTCSMVFDG----YRVCLRP 228

  Fly   281 IAKG------EILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKAG 339
            :..|      |...|||....||...||..|.....|:|.|.||.|||:     .|.|.::|   
 Worm   229 LVPGVDAENTEEAFISYIDVGRSKYIRRRDLNSRWYFNCECTRCMDPED-----DALTAIRC--- 285

  Fly   340 KIISLNPL-------------LNSAPWKCQLC---NFKRSAKDVVTS-----DAELQQELESLDK 383
                .||.             :|.|..||:..   :..::|::.:.:     |.:...|:|:|  
 Worm   286 ----ANPACDAPILTSETEEPMNIACEKCKTIVEEDTVKAAQEYMKTLPASFDPKCPAEIEAL-- 344

  Fly   384 TTPVALEEFIYRHRADLHETNTHILQAKYALTQLYGSAPGFAMEELSG--ESLNRKLQLC----- 441
              |..|:|.:.:....||.:|.::.:.:.||..:.|:   ..|:.||.  ..:....::|     
 Worm   345 --PGKLKELLAKAEQILHPSNVYVARLRTALFHVTGT---LTMDNLSSMHTQIYNNYKMCFPKAD 404

  Fly   442 --------------------EELLKLADIFDGGWSIFRGNLLIDMEEALVTQALRSKDPLDCEEK 486
                                :|.:..|  || ..:||.....:|....|.|.||.:.    .|:|
 Worm   405 RHVGFQLLHIVKALIEKDERDEAMPYA--FD-AMNIFEVCFGLDHPYYLQTLALWTY----LEKK 462

  Fly   487 LRNAAEMLREIRNIMKHEPEMQQLLLERQVIL 518
            :..:.|.|.::.|...:.|.....||:|..:|
 Worm   463 IPKSTEELVQLTNFSDNRPIDIVSLLKRANML 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 12/50 (24%)
set-18NP_871849.1 zf-MYND 49..90 CDD:280009 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.