DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and SMYD1

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_938015.1 Gene:SMYD1 / 150572 HGNCID:20986 Length:490 Species:Homo sapiens

Alignment Length:551 Identity:113/551 - (20%)
Similarity:200/551 - (36%) Gaps:152/551 - (27%)


  Fly    50 EIATNEVLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSC 114
            |:.|.|..||.|:||::....:.|..|.  .....|..:.:...||...    |.:...|:|..|
Human    10 EVFTAEGKGRGLKATKEFWAADIIFAER--AYSAVVFDSLVNFVCHTCF----KRQEKLHRCGQC 68

  Fly   115 SWP-LCGKECEDS--VHHKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKD-- 174
            .:. .|.:.|:..  ::||.||..:      .:...||.|..|        :..|.|...:::  
Human    69 KFAHYCDRTCQKDAWLNHKNECSAI------KRYGKVPNENIR--------LAARIMWRVEREGT 119

  Fly   175 ---PDAFLKLYNLEDHLKERLETPLYQVLRANLITFIKTVLGMKDWPEMD-------ILRIAAIL 229
               ....:.:.:|::|: |.......:.||.::.||::.      ||...       |..|..::
Human   120 GLTEGCLVSVDDLQNHV-EHFGEEEQKDLRVDVDTFLQY------WPPQSQQFSMQYISHIFGVI 177

  Fly   230 DTNTFEVRQPRERRKIR-ALYPGAAMISHDCVPN------------MRHRFDDDMNIVFLAKRKI 281
            :.|.|.:...|..:.:. .::|...:::|||.||            ::..|...|.|...|..||
Human   178 NCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALGKI 242

  Fly   282 AKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKAGKIISLNP 346
            ::||.|::||...|..:.:|:..|::...|||:|..||...:...|.|.:.            ||
Human   243 SEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQKKLKDDLFLGVKD------------NP 295

  Fly   347 LLNSAPWKCQLCNFKRSAKDVVTSDAELQQE-LESLDKTTPVALEEFIYRHRADLHETNTHILQA 410
                           :.:::||....:..:: ||.:||    |..|.:|.....|........:.
Human   296 ---------------KPSQEVVKEMIQFSKDTLEKIDK----ARSEGLYHEVVKLCRECLEKQEP 341

  Fly   411 KYALTQLYGSAPGFAMEELSGESLNRKLQLCEELLKLADIF-----------DG----------- 453
            .:|.|.:|               :.|.|.:..|:|.....|           ||           
Human   342 VFADTNIY---------------MLRMLSIVSEVLSYLQAFEEASFYARRMVDGYMKLYHPNNAQ 391

  Fly   454 -GWSIFRGNLL------IDMEEALVTQALR------------SKDPLDCEEKLRNAAEMLREIRN 499
             |.::.|..|.      |::...::.:|..            :||    .|.:|...||  |:|.
Human   392 LGMAVMRAGLTNWHAGNIEVGHGMICKAYAILLVTHGPSHPITKD----LEAMRVQTEM--ELRM 450

  Fly   500 IMKHE---PEMQQLLLERQVILSSALERFEP 527
            ..::|   .:|::..|..|.:...|....||
Human   451 FRQNEFMYYKMREAALNNQPMQVMAEPSNEP 481

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 15/57 (26%)
SMYD1NP_938015.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 0/1 (0%)
zf-MYND 52..90 CDD:307734 10/41 (24%)
SET <194..257 CDD:214614 17/62 (27%)