DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and Smyd1

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001153599.1 Gene:Smyd1 / 12180 MGIID:104790 Length:490 Species:Mus musculus

Alignment Length:530 Identity:115/530 - (21%)
Similarity:202/530 - (38%) Gaps:110/530 - (20%)


  Fly    50 EIATNEVLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSC 114
            |:.|:|..||.|:||::....:.|..|.  .....|..:.:...||...    |.:...|:|..|
Mouse    10 EVFTSEGKGRGLKATKEFWAADVIFAER--AYSAVVFDSLINFVCHTCF----KRQEKLHRCGQC 68

  Fly   115 SWP-LCGKECEDS--VHHKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKD-- 174
            .:. .|.:.|:..  ::||.||..:      .|...||.|..|        :..|.|...:::  
Mouse    69 KFAHYCDRTCQKDAWLNHKNECAAI------KKYGKVPNENIR--------LAARIMWRVEREGT 119

  Fly   175 ---PDAFLKLYNLEDHLKERLETPLYQVLRANLITFIKTVLGMKDWPEMD-------ILRIAAIL 229
               ....:.:.:|::|: |.......:.||.::.||::.      ||...       |..|..::
Mouse   120 GLTEGCLVSVDDLQNHV-EHFGEEEQKELRVDVDTFLQY------WPPQSQQFSMQYISHIFGVI 177

  Fly   230 DTNTFEVRQPRERRKIR-ALYPGAAMISHDCVPN------------MRHRFDDDMNIVFLAKRKI 281
            :.|.|.:...|..:.:. .::|...:::|||.||            ::..|...|.|...|..||
Mouse   178 NCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALGKI 242

  Fly   282 AKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKAGKIISLNP 346
            ::||.|::||...|..:.:||..|::...|||||..||...:...|..|:.            :|
Mouse   243 SEGEELTVSYIDFLHLSEERRRQLKKQYYFDCSCEHCQKGLKDDLFLAAKE------------DP 295

  Fly   347 LLNSAPWKCQLCNFKRSAKDVVTSDAELQQE-LESLDKTTPVAL--------EEFIYRHRADLHE 402
                           :.:::||....:..:: ||.:||.....|        .|.:.:......:
Mouse   296 ---------------KPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFAD 345

  Fly   403 TNTHILQ----AKYALT--QLYGSAPGFAMEELSG-----ESLNRKLQLCEELLKLADIFDGGWS 456
            ||.::|:    |...|:  |.|..|..:|...:.|     ...|.:|.:......|.:...|...
Mouse   346 TNLYVLRLLSIASEVLSYLQAYEEASHYARRMVDGYMKLYHHNNAQLGMAVMRAGLTNWHAGHIE 410

  Fly   457 IFRGNLLIDMEEALVTQALRSKDPLDCE-EKLRNAAEMLREIRNIMKHE---PEMQQLLLERQVI 517
            :..|.:.......|||..  ...|:..: |.:|...||  |:|...::|   .:|::..|..|.:
Mouse   411 VGHGMICKAYAILLVTHG--PSHPITKDLEAMRMQTEM--ELRMFRQNEFMYHKMREAALNNQPM 471

  Fly   518 LSSALERFEP 527
            ...|....||
Mouse   472 QVMAEPSNEP 481

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 15/57 (26%)
Smyd1NP_001153599.1 S-adenosyl-L-methionine binding 17..19 0/1 (0%)
zf-MYND 52..90 CDD:280009 10/41 (24%)
SET <194..257 CDD:214614 17/62 (27%)