DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and SMYD4

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_443160.2 Gene:SMYD4 / 114826 HGNCID:21067 Length:804 Species:Homo sapiens

Alignment Length:594 Identity:120/594 - (20%)
Similarity:208/594 - (35%) Gaps:184/594 - (30%)


  Fly     9 CALC--QAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVLGRHLRATRDIKIGE 71
            |..|  ...|:..|..|....|||:|..::.|:..||:||....:.....:..|:.....:.:|.
Human   296 CHRCLKHTLATVPCDGCSYAKYCSQECLQQAWELYHRTECPLGGLLLTLGVFCHIALRLTLLVGF 360

  Fly    72 QILKEAPLVLGPKVASAPLCLGCHRNL-------LAPGKPRGNYHKCSSCSWPLCGKECEDSVHH 129
            :.:::....|..|:::..:||....|.       |...:..||.     ...|:.|  |:  ::.
Human   361 EDVRKIITKLCDKISNKDICLPESNNQVKTLNYGLGESEKNGNI-----VETPIPG--CD--ING 416

  Fly   130 KAECQLMSGSNFQSKINYVPGEEERKES-----AYCVIMLLRCMHLKDKDPDAFLKLYNLEDHLK 189
            |.|      :|:.:..|.:|..|.....     |.||..|.|                       
Human   417 KYE------NNYNAVFNLLPHTENHSPEHKFLCALCVSALCR----------------------- 452

  Fly   190 ERLETPLYQVLRANLI---TFIKTVLGMKDWPEMDILRIAAI-----LDTN-----TFEVRQPR- 240
             :||....|.:....|   :.:|..:..:..|::.|..:|.:     |..|     |.:...|: 
Human   453 -QLEAASLQAIPTERIVNSSQLKAAVTPELCPDVTIWGVAMLRHMLQLQCNAQAMTTIQHTGPKG 516

  Fly   241 ----ERRKIR---ALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRST 298
                :.|::|   .::|..::::|.|.||....|...:..: .|.::|.||:.:...| .|.:|.
Human   517 SIVTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTVATI-RASQRIRKGQEILHCY-GPHKSR 579

  Fly   299 I---QRRVHLRQAKCFDCSCARCQDPEELGSFAG----AQTCLKCKAGKIISLNPLLNSAPWKCQ 356
            :   :|:..||....|||:|..|| .|.....||    |..|..|.|       |:......:|.
Human   580 MGVAERQQKLRSQYFFDCACPACQ-TEAHRMAAGPRWEAFCCNSCGA-------PMQGDDVLRCG 636

  Fly   357 LCNFKRSAKDVVTSDAELQQELESLDKTTPVA----------------------LEEFIYRHRA- 398
                .||..:...|...|...|:.|.:...||                      .|.|::...| 
Human   637 ----SRSCAESAVSRDHLVSRLQDLQQQVRVAQKLLRDGELERAVQRLSGCQRDAESFLWAEHAV 697

  Fly   399 ----------------DLHETNTHILQAKYALTQLYGSAPGFAMEELSGESLNRKLQLCEELLKL 447
                            |..::.||:.::.|.:...:|.:               .:::..||.||
Human   698 VGEIADGLARACAALGDWQKSATHLQRSLYVVEVRHGPS---------------SVEMGHELFKL 747

  Fly   448 ADIFDGGWSIFRGNLLIDMEEALVTQALRSKDPLDCEEKLRNAAEMLR--------EIRNIMKHE 504
            |.||..|:::         .|||.|              ::.|.|:|.        ||:.:.|  
Human   748 AQIFFNGFAV---------PEALST--------------IQKAEEVLSLHCGPWDDEIQELQK-- 787

  Fly   505 PEMQQLLLE 513
              |:..||:
Human   788 --MKSCLLD 794

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 12/38 (32%)
SET <246..291 CDD:214614 11/47 (23%)
SMYD4NP_443160.2 TPR repeat 68..96 CDD:276809
PLN03088 <72..>237 CDD:330826
TPR repeat 101..135 CDD:276809
S-adenosyl-L-methionine binding. {ECO:0000250} 112..114
TPR repeat 143..171 CDD:276809
zf-MYND 296..335 CDD:307734 12/38 (32%)
SET <528..574 CDD:307139 11/47 (23%)