DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and smyd3

DIOPT Version :9

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_031758360.1 Gene:smyd3 / 100494527 XenbaseID:XB-GENE-854970 Length:448 Species:Xenopus tropicalis


Alignment Length:537 Identity:113/537 - (21%)
Similarity:184/537 - (34%) Gaps:221/537 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TSCALCQAKASQL--CAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVLGRHLRATRDIKI 69
            |:|..|..:..:|  |:.|:...||:...|::.| :||:.||:|.......|....:|.     :
 Frog    65 TACDHCLHRKEKLLRCSQCKVARYCNSHCQRKAW-QGHKRECKCLRSTLPNVPPNSVRL-----V 123

  Fly    70 GEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWPLCGKECEDSVHHKAECQ 134
            |:.|.|   ::..|..||.                                             :
 Frog   124 GKIIFK---MLQKPDTASE---------------------------------------------E 140

  Fly   135 LMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDAFLKLYNLEDHLKERLE-----T 194
            |.:.|:.||.|.  ...||.|:.       ||  ||...          |:.:|||.::     .
 Frog   141 LYTISDLQSHIK--EASEEVKDG-------LR--HLATA----------LQHYLKEEIQEISQLP 184

  Fly   195 PLYQVLRANLITFIKTVLGMKDWPEMDILRIAAILDTNTFEVRQPRERRKIRALYPGAAMISHDC 259
            |.:|||.         ..|          :::|.:..|:|.:.....:.....|||..::::|.|
 Frog   185 PGFQVLE---------YFG----------KVSAKVTCNSFTISDGEMQDVGVGLYPSMSLLNHSC 230

  Fly   260 VPNMRHRFDDDMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARC--QDPE 322
            .||....|:... ::....::|.|||.|:|||......|..||..|::..||.|.|.||  :|.:
 Frog   231 DPNCVIVFEGTC-LLLRTVKEIPKGEELTISYIDVKMPTQGRRDQLQRQYCFLCDCQRCLLRDKD 294

  Fly   323 ELGSFAGAQTCLKCKAGKIISLNPLLNSAPWKCQLCNFKRSAKDVVTSDAELQQELESLDKTTPV 387
            |                                          |::..|||..:|:||    :..
 Frog   295 E------------------------------------------DMLAGDAEASREVES----SVS 313

  Fly   388 ALEEFIYRHRADLHETNTHILQAKYALTQLYGSAPGFAMEELSGESLNRKLQLCEELLKLADIFD 452
            .|||.:.::.|:                                |:||    ||:.|:....:.|
 Frog   314 RLEELLSQNTAE--------------------------------EALN----LCKTLMNRYYLPD 342

  Fly   453 GGWSIFRGNLL-------IDM---EEALVTQALRSKDP---------------LDCEEKLRN--- 489
            .  :|::..:|       ||:   |||| ...||:.:|               |....||:|   
 Frog   343 K--NIYQLKILDCAMDASIDLGLWEEAL-HFGLRTLEPYSLYYSNYHPVRAVQLMKVGKLQNYQG 404

  Fly   490 ----AAEMLREIRNIMK 502
                |.:.|::..:|||
 Frog   405 LFAEAMKTLKQAFDIMK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 11/38 (29%)
SET <246..291 CDD:214614 14/44 (32%)
smyd3XP_031758360.1 SET_SMYD3 24..289 CDD:380980 72/318 (23%)
zf-MYND 67..105 CDD:396356 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.