DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-2 and smyd3

DIOPT Version :8

Sequence 1:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_004914683.1 Gene:smyd3 / 100494527 XenbaseID:XB-GENE-854970 Length:444 Species:Xenopus tropicalis

Alignment Length:532 Identity:109/532 - (20%)
Similarity:179/532 - (33%) Gaps:215/532 - (40%)


  Fly     7 TSCALCQAKASQL--CAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVLGRHLRATRDIKI 69
            |:|..|..:..:|  |:.|:...||:...|::.| :||:.||:|.......|....:|.     :
 Frog    65 TACDHCLHRKEKLLRCSQCKVTRYCNSHCQRKAW-QGHKRECKCLRSTLPNVPPNSVRL-----V 123

  Fly    70 GEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWPLCGKECEDSVHHKAECQ 134
            |:.|.|   ::..|..||.                                             :
 Frog   124 GKIIFK---MLQKPDTASE---------------------------------------------E 140

  Fly   135 LMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDAFLKLYNLEDHLKERLETPLYQV 199
            |.:.|:.||.|.  ...||.|:.       ||  ||      |....:.|::.::|..:.|    
 Frog   141 LYTISDLQSHIK--EASEEVKDG-------LR--HL------ATALQHYLKEEIQEISQLP---- 184

  Fly   200 LRANLITFIKTVLGMKDWPEMDILRIAAILDTNTFEVRQPRERRKIRALYPGAAMISHDCVPNMR 264
                              |...:|.....:..|:|.:.....:.....|||..::::|.|.||..
 Frog   185 ------------------PGFQVLEYFGKVTCNSFTISDGEMQDVGVGLYPSMSLLNHSCDPNCV 231

  Fly   265 HRFDDDMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARC--QDPEELGSF 327
            ..|:... ::....::|.|||.|:|||......|..||..|::..||.|.|.||  :|.:|    
 Frog   232 IVFEGTC-LLLRTVKEIPKGEELTISYIDVKMPTQGRRDQLQRQYCFLCDCQRCLLRDKDE---- 291

  Fly   328 AGAQTCLKCKAGKIISLNPLLNSAPWKCQLCNFKRSAKDVVTSDAELQQELESLDKTTPVALEEF 392
                                                  |::..|||..:|:||    :...|||.
 Frog   292 --------------------------------------DMLAGDAEASREVES----SVSRLEEL 314

  Fly   393 IYRHRADLHETNTHILQAKYALTQLYGSAPGFAMEELSGESLNRKLQLCEELLKLADIFDGGWSI 457
            :.::.|:                                |:||    ||:.|:....:.|.  :|
 Frog   315 LSQNTAE--------------------------------EALN----LCKTLMNRYYLPDK--NI 341

  Fly   458 FRGNLL-------IDM---EEALVTQALRSKDP---------------LDCEEKLRN-------A 490
            ::..:|       ||:   |||| ...||:.:|               |....||:|       |
 Frog   342 YQLKILDCAMDASIDLGLWEEAL-HFGLRTLEPYSLYYSNYHPVRAVQLMKVGKLQNYQGLFAEA 405

  Fly   491 AEMLREIRNIMK 502
            .:.|::..:|||
 Frog   406 MKTLKQAFDIMK 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 11/38 (29%)
SET <246..291 CDD:214614 14/44 (32%)
smyd3XP_004914683.1 zf-MYND 67..105 CDD:280009 11/38 (29%)
SET <219..257 CDD:279228 11/38 (29%)
TPR_12 <356..417 CDD:290160 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.