DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and zgc:158445

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001073540.2 Gene:zgc:158445 / 798069 ZFINID:ZDB-GENE-061215-78 Length:261 Species:Danio rerio


Alignment Length:210 Identity:48/210 - (22%)
Similarity:79/210 - (37%) Gaps:69/210 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 ICFNEEEE--VTRYTRHKLEP---GSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLETINNE 234
            ||..:::.  .|.|...|..|   ..||.:|.|.                   |:..:...|:.|
Zfish    58 ICQGKDKAYFATLYDTTKKIPVFSAYNYIKTDVK-------------------TKRKKTFVIDTE 103

  Fly   235 LGGDAEKYFD--SSSNVYLARGHLGAKADFDYAPEQR---ATFLFINAAPQWQTFNAGNWARVED 294
            |.....|..|  .|:.:.::||||..|:   ||.:|.   |||...|..||.:.||.|.|::.|:
Zfish   104 LQDAQAKNEDYRQSNKIEMSRGHLFPKS---YAVDQEAAYATFTLTNVVPQQKKFNNGEWSKKEN 165

  Fly   295 GLRAWVSKNKLNVNCYTG--------VYGV-----TTLPNKDGVETPLYLA-------------- 332
            ..     |:.::.:|.:.        |.|.     |.|.:|..:.|.:|:|              
Zfish   166 EF-----KSSMDTDCLSNNGRPEAFVVTGAIPSEKTLLNDKVNIPTHMYMAFCCYNKNTKKWVTK 225

  Fly   333 -----KDDNNNGLIP 342
                 .::|:..::|
Zfish   226 AYCATNEENSRAVLP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 48/210 (23%)
zgc:158445NP_001073540.2 Endonuclease_NS 64..227 CDD:214889 44/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.