DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6839 and endog

Sequence 1:NP_649076.1 Gene:CG6839 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001017202.1 Gene:endog XenbaseID:XB-GENE-998565 Length:293 Species:Xenopus tropicalis

Alignment Length:336 Identity:82/337 (24%)
Similarity:133/337 (39%) Gaps:82/337 (24%)


  Fly   118 VSGTTFSVGGSNFEFKDLYCKSWPGFKAVKS--GATCNGGIVIRVGFEITSSRFAEQMQICFNEE 180
            :||.:.:||.:          ...|..|.:|  ||. |.|::..:||:...:    ..|:.....
 Frog     9 LSGVSLAVGAA----------LGAGVAAWRSRDGAG-NVGVLDILGFQTVQA----STQLSLPPS 58

  Fly   181 EEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLETINNE-LGGDAEKY-- 242
            ..:||:..    ||.:..::..:.:.     .:|    .:|...|..||.::.| |.|.||:.  
 Frog    59 AGLTRFGL----PGLSQLKSRESYVL-----SYD----PRLRGPAWVLEHLSPERLHGSAERQGC 110

  Fly   243 -FDSSSNVY--------------LARGHLGAKADFDYAPEQRA---TFLFINAAPQWQTFNAGNW 289
             |....:|:              ..||||.|.|:..::  |:|   ||:..|..||....|...|
 Frog   111 DFQEDVSVHQYHRAANSDFKGSGFDRGHLAAAANHKWS--QKAMDETFILSNIYPQNPHLNQKAW 173

  Fly   290 ARVEDGLRAWVSKNKLNVNCYTGVYGVTTLPNK--DGVETPLYLAKDDNNNGLIPVPKLYFRVVI 352
            ..:|...|:...||| ||...|   |...||.:  ||.....|.....||   :.||..:|:||:
 Frog   174 NNLERYCRSLTKKNK-NVYVCT---GPLFLPRREPDGNMYVKYQVIGSNN---VAVPTHFFKVVV 231

  Fly   353 DPSSHRGIV----FVGVNNPHLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGWSYACEVADFL 413
             .....|.:    :|..|:|  .:|||..:..:          :..::.:..||..:   |.:.|
 Frog   232 -LEKFSGEIELRSYVMPNHP--VDEQIPLERFL----------VPIESIERAAGLLF---VPNIL 280

  Fly   414 KTVKHLPALTA 424
            |...:|.|:||
 Frog   281 KNTNNLKAITA 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 66/277 (24%)
endogNP_001017202.1 NUC 75..282 CDD:214683 60/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.