DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6839 and Tengl4

Sequence 1:NP_649076.1 Gene:CG6839 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_650038.2 Gene:Tengl4 FlyBaseID:FBgn0037857 Length:378 Species:Drosophila melanogaster

Alignment Length:337 Identity:62/338 (18%)
Similarity:105/338 (31%) Gaps:124/338 (37%)


  Fly   116 SCVSGTTFSVG--GSNFE----FKDLYCKSWPGFKAVKSGATCNGGIVIRVGFEITSSR------ 168
            :.:|..|.|||  ||..|    ..|:....:||...:.          :...|.::..|      
  Fly   111 NAISKMTLSVGPNGSRHENIEHVADIMKYGFPGMDEIH----------VYKNFVLSYDRRNRIAH 165

  Fly   169 -FAEQMQI-CFNEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLETI 231
             ..|.::. |..|.:|.|..     :|  |.|.|.....|..:|...|.||.|            
  Fly   166 WVCEHVKSGCVQERDEKTLN-----KP--NAYITDNTIPTIFSANMRDFKNSD------------ 211

  Fly   232 NNELGGDAEKYFDSSSNVYLARGHLGAKADFDY-APEQRATFLFINAAPQWQTFNAGNWARVEDG 295
                               ...|||.:..::.. |.:....:.|.|..|..:......|.|:|..
  Fly   212 -------------------WVGGHLASPQNYKCDALKFLEAYKFTNIVPINRGLKNHIWYRLESY 257

  Fly   296 LRAWVSKNKL----NVNCYTGVYGVTTLPNKDGVETPLYLAKDDN-----------NNGLIPVPK 345
            :|     :|.    :|:.|||               ||::.:...           ....:.||.
  Fly   258 VR-----DKAIEFDSVHVYTG---------------PLFMPQRITFRNWSVRYHVMGMNTVAVPT 302

  Fly   346 LYFRVVIDPSSHRGIVFVGVNNPHLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGWSYACEVA 410
            .:|:::|                  .|::..||..|.:.......|:: |..|::   |:..:|.
  Fly   303 HFFKIII------------------REDEFNRDMPIMEGYVVPNAYVD-KDMDLR---SFLADVR 345

  Fly   411 DFLKTVKHLPAL 422
            |    ::|...|
  Fly   346 D----IEHFAGL 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 48/267 (18%)
Tengl4NP_650038.2 Endonuclease_NS 132..362 CDD:279553 54/317 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2230056
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.