DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6839 and CG14118

Sequence 1:NP_649076.1 Gene:CG6839 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_648612.1 Gene:CG14118 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster

Alignment Length:442 Identity:136/443 (31%)
Similarity:230/443 (52%) Gaps:52/443 (12%)


  Fly     7 SLLVVGLLAAPAAWARVPCPEVELPPVVED-DGIF---ERIAVAPPQPVGRAGACSVTIRGGLP- 66
            :::::..:.|..|.|.:|    ::..:::| ||:.   |......|        |.|.::..|| 
  Fly    11 AVVILREIRAREAIATIP----DVGQIIKDLDGLHIDGEMFHQGSP--------CRVDVQNDLPR 63

  Fly    67 --SPEPVYLKTDSEDFYPFSDVGVMEFESGGSLQLWCPSGF-NTHSENL------LTASCVSGTT 122
              ..:|:||:..::.::..:..|.:|.:.|.|::|.|...| ..:.|:|      :...||..||
  Fly    64 LDKVQPLYLRPGTDLYWLPNAYGHLEVQRGASIELHCSHSFAPANGESLDAKLRSIRVKCVQDTT 128

  Fly   123 FSVGGSNFEFKDLYCKSWPGFKAVKSGATCNG-------GIVIRVGFEITSSRFAEQMQICFNEE 180
            |...|:...|.|..|.....:...:...:|..       ..:.|||::....||...|::|.:..
  Fly   129 FEWMGAKIHFSDFVCNHSMPYTVERLDRSCGSDTPSPSTSYLYRVGYDTGDGRFVATMELCHDPN 193

  Fly   181 EEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLETINNELGGDAEKYFDS 245
            :..|.|..|:|.|.:.:::..:.|..|.|||.|.|.::.::|:..:|.:.:...|       .|.
  Fly   194 QLRTHYAHHQLTPANVHFQKKLKRPRFSTAGHFTGFDMARIYSPKSQEKLMVPGL-------IDV 251

  Fly   246 SSNVYLARGHLGAKADFDYAPEQRATFLFINAAPQWQTFNAGNWARVEDGLRAWVSKNKLNVNCY 310
            .|.::||||||.||||..||.:|:::|.::|.|||||:||.|.|:::|:..|.:|:::.:....|
  Fly   252 KSGLFLARGHLTAKADLIYASQQKSSFNYMNVAPQWQSFNGGQWSKLEESTRQYVARSGITATVY 316

  Fly   311 TGVYGVTTLPNKDGVETPLYLAKDDNNNGLIPVPKLYFRVVIDPSSH--RGIVFVGVNNPHLTEE 373
            ||:||    ..|......|::..:.||.|::.||:|::||:|| ..|  |||..|||||||.|..
  Fly   317 TGIYG----EMKVAGSKVLHMTTNANNIGVVAVPQLFYRVLID-EGHPTRGIALVGVNNPHATLA 376

  Fly   374 QIKRDYVICDDVSDQVTYINW--KTT---DIKAGWSYACEVADFLKTVKHLP 420
            ||...|:|||.|.:.|.:::|  |:.   ::|.|:.|||.||:..:.|.|||
  Fly   377 QIHESYIICDPVEESVQWLSWLHKSNAKGNLKNGYLYACSVANLARAVGHLP 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 95/257 (37%)
CG14118NP_648612.1 NUC 175..428 CDD:238043 97/265 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131121845
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112751at2759
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.