DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and CG14120

DIOPT Version :9

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster

Alignment Length:381 Identity:169/381 - (44%)
Similarity:238/381 - (62%) Gaps:25/381 - (6%)


  Fly    57 CSVTIRGGLPSPEPV-----------YLKTDSEDFYPFSDVGVMEFESGGSLQLWCPSGFN--TH 108
            ||..:.|.|..|.|:           ||:.:.|        ||::.:.|.:|:..|.:.|:  ..
  Fly   987 CSFKVNGDLKDPAPLFVVRSELGHARYLEPNQE--------GVVQLKHGEALEFHCINSFSGPFS 1043

  Fly   109 SENLLTASCVSGTTFSVGGSNFEFKDLYCKSWPGFKAVKSGATCNGGI-VIRVGFEITSSR---F 169
            ....:.::|....:....||.::.:|..|.|||.:.|.:||..||||. ::.|||:::||.   |
  Fly  1044 GYTFVNSTCWQQQSILAMGSLYQLQDFVCTSWPTYTARRSGRPCNGGTDLLEVGFQLSSSSSDDF 1108

  Fly   170 AEQMQICFNEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLYTQATQLETINNE 234
            .:...:|.:|..|||||..|.|.|||:.|:..|:|.:|....|:.||:|:.||||..|..|::..
  Fly  1109 LQTYDVCHDELSEVTRYVHHVLYPGSDQYQRSVSRPSFIPGDFYGGKDVNTLYTQVQQNITVSEI 1173

  Fly   235 LGGDAEKYFDSSSNVYLARGHLGAKADFDYAPEQRATFLFINAAPQWQTFNAGNWARVEDGLRAW 299
            ||.||..||:::.|||||||||.||.||.:...|:|:|.|:||||||||||.|||.|:||.:|.:
  Fly  1174 LGMDASPYFNTTGNVYLARGHLSAKTDFVFGAAQKASFFFVNAAPQWQTFNGGNWERIEDSVRKF 1238

  Fly   300 VSKNKLNVNCYTGVYGVTTLPNKDGVETPLYLAKDDNNNGLIPVPKLYFRVVIDPSSHRGIVFVG 364
            |:...:.|:||||.:||:|||:.:|:...|||..|:|||||||||||||||:||..|..|||.:|
  Fly  1239 VADENITVDCYTGTWGVSTLPDVNGIGRELYLDFDENNNGLIPVPKLYFRVIIDRESRNGIVLLG 1303

  Fly   365 VNNPHLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGWSYACEVADFLKTVKHLP 420
            |||||.|.|||:.:|:||.|:..|:::::|...|:|.|:||||.|.||...||.||
  Fly  1304 VNNPHATIEQIEEEYIICQDIGAQLSWVSWTKEDLKKGYSYACTVEDFTAVVKDLP 1359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 131/249 (53%)
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043 131/247 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472898
Domainoid 1 1.000 251 1.000 Domainoid score I4806
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102209at6960
OrthoFinder 1 1.000 - - FOG0014393
OrthoInspector 1 1.000 - - mtm9727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.