DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6839 and Exog

DIOPT Version :8

Sequence 1:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006244150.1 Gene:Exog / 301062 RGDID:1304628 Length:392 Species:Rattus norvegicus

Alignment Length:333 Identity:72/333 - (21%)
Similarity:119/333 - (35%) Gaps:115/333 - (34%)


  Fly   137 CKSWPG----FKAVKSGATCNGGIVI-RVGFEITSSRFAEQMQICFNEEEEVTRYTRHKLEPGSN 196
            |.:.||    ||:|:.       :|: :.||.:|.:              |..|||.|.|.    
  Rat    68 CSTVPGTELAFKSVEK-------VVLEQFGFPLTGT--------------ETRRYTNHALS---- 107

  Fly   197 YYETGVARITFQTAGFFDGKNVDKLYTQATQ-----LETIN-NELGGDAEK-------------Y 242
                                     |.||.:     ||.|: :::.|||::             .
  Rat   108 -------------------------YDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPTVPSA 147

  Fly   243 FDSSSNVYL----ARGHLGAKADFDYAPEQRA-TFLFINAAPQWQTFNAGNWARVEDGLR----- 297
            |.:.:..|:    :|||:....:..::.|..| ||...|..||....|:|.|.|:|...|     
  Rat   148 FSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFENNSGYWNRIEMYCRELTER 212

  Fly   298 ---AWVSKNKLNVNCYTGVYGVTTLPN--KDGVETPLYLAKDDNNNGLIPVPKLYFRVVI---DP 354
               .|:            |.|..|||:  .||.:|..|....::|   :.||...::|::   .|
  Rat   213 FEDVWI------------VSGPLTLPHTRNDGTKTVSYQVIGEDN---VAVPSHLYKVILARRSP 262

  Fly   355 SSHRGI---VFVGVNNPHLTEEQIKRDYVICDDVSDQVTYINW----KTTDIKAGWSY-ACEVAD 411
            .|...:   .||..|.....:.|:....|...|:......:.:    :|.||:...|. .|::..
  Rat   263 ESTEPLALGAFVVPNKAIGFQSQLSEFQVSLHDLEKMSGLVFFPHLDRTRDIRNICSVDTCKLLG 327

  Fly   412 FLKTVKHL 419
            |.:...:|
  Rat   328 FQEFTLYL 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6839NP_649076.1 NUC 170..420 CDD:238043 62/295 (21%)
ExogXP_006244150.1 NUC 101..310 CDD:214683 53/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2228785
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.